KEGG   Mycoplasma gallisepticum CA06_2006.052-5-2P: HFMG06CAA_4820Help
Entry
HFMG06CAA_4820    CDS       T02326                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mgac  Mycoplasma gallisepticum CA06_2006.052-5-2P
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgac03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(823977..824657)
Genome map
AA seq 226 aa AA seqDB search
MITSVYAKIEYVTNTKMLFVANNWGYWVNVKPNSGFSRTDNNVLVFLHELTFLAQNNAIN
KELYAFKSLKEKEWFKALLTINGIGPKTAMNVMVNKQEEVLTLIKNNDLNGLLRLENINK
KVATMLLASDIASKHYLKNQIVVSDKVEPQIDDDEKIDDSKDLNDDELLSEIVIEAIDCL
ISLGYKQEQIKTALAEIDLKNESINDSADLVAVIIKQIGLRTSEVS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcacttctgtatacgcaaaaatagaatatgtgacaaacacaaagatgttgtttgtt
gccaataactgaggttattgggtaaatgtaaaaccaaatagtggttttagtcgcactgac
aataatgttcttgttttcttacacgaactaacctttttagcacagaacaatgctattaat
aaagaactatatgcttttaagagtttaaaagaaaaagaatggttcaaggcactgttaacg
atcaatggcattggccctaaaacagccatgaacgtaatggtaaataaacaagaagaggta
ctaaccttaattaaaaacaatgacttaaacggcttgttaagattagaaaacattaataag
aaagttgccacaatgttgttagcttcagatattgctagtaagcactatctgaagaaccaa
attgttgttagtgataaagttgaaccacaaatagatgacgatgagaaaattgatgatagc
aaagacctaaatgatgatgaattattatcagagatcgtgattgaagcaattgattgttta
atcagtctaggatataaacaagagcaaataaaaacggcgttagctgaaattgatttaaaa
aacgaatcaattaatgattcggctgatcttgtggcagtaatcattaaacaaataggctta
agaacaagtgaagttagctag

DBGET integrated database retrieval system