KEGG   Mycoplasma gallisepticum NC08_2008.031-4-3P: HFMG08NCA_0063Help
Entry
HFMG08NCA_0063    CDS       T02327                                 

Gene name
ispE
Definition
diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mgan  Mycoplasma gallisepticum NC08_2008.031-4-3P
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mgan00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10769..11554
Genome map
AA seq 261 aa AA seqDB search
MVLKKHPELKSYHLPNCLAYMNHYRSYAKVNFYLKIKEYCPKVKKHKLESKLVLVKDLYD
DLYLEKSNQTKIEYFDQNDNPLTFSDDILVRTKKFLEDKLNQNFEFKAKVIKRIPTLSGL
GSAPSNAAVLINWIYQEYGILNPVSYYEIATELGSDIPFFLSLHDCAIIKNFGDQVEQSI
LDGYEIEKIIFNKQKPSTKKIFELLDYSQIKKENLNDLEQPFFSLFPELLPSFNQLKNDN
NHVVLAGAGSCFVVFRKLNEI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttggttttaaaaaaacatccagagctcaagagttatcacctacccaactgtttagcttat
atgaatcattatcgaagttatgctaaagttaatttttatctaaaaattaaggaatactgt
ccaaaagttaaaaagcataaacttgagtccaagttggttctagttaaagatctttatgat
gatctttatttagaaaaatcgaaccaaactaagattgagtactttgatcaaaatgataac
cctttaacatttagtgatgatattttagttaggactaagaaatttttagaagataagtta
aatcaaaattttgaatttaaagcgaaggtgattaaaagaattccgaccctttctggactt
ggctcagctccaagtaatgcagctgttttgattaattgaatttatcaagaatatggaatc
cttaacccggttagttattatgaaatagccactgagctaggtagtgatattccctttttc
ttatccttacatgattgcgcaattattaagaattttggggatcaagtagaacaatctatt
ttggatgggtatgaaatagaaaagatcatttttaacaaacaaaaacctagtacaaaaaag
atctttgaactattagattattctcaaattaaaaaagaaaatcttaatgatttagaacaa
cctttttttagtttatttcccgaattattaccatcttttaatcaattaaaaaatgacaac
aatcacgttgtgttagcaggagctggaagctgctttgtcgtatttagaaagctaaatgaa
atataa

DBGET integrated database retrieval system