KEGG   Mycoplasma gallisepticum NC08_2008.031-4-3P: HFMG08NCA_0660Help
Entry
HFMG08NCA_0660    CDS       T02327                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mgan  Mycoplasma gallisepticum NC08_2008.031-4-3P
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgan00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HFMG08NCA_0660 (dxr)
Enzymes [BR:mgan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HFMG08NCA_0660 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108582..109688
Genome map
AA seq 368 aa AA seqDB search
MKILVLGATGSIGKQTIDVICQLKYQLVGFSYYQNHNEANNILKQLNPNYVLCHSDPKYN
KNVKSDLIELIDKSKPKVIINAINGYHGIEASLIALSKKKDLLLANKESLVIAGSQLEAI
RKDTKTTIYPIDSEHSALYDLLKDKKKNQIKQLMITASGAGYFNKDISELRKLTYNDLLN
HPNWKMGAEISINSATFVNKVYEIVEAYHLFKIKDIIPVVERSSTIHAGVIYQDNSIHFH
ATTNDMRWAIQSALTKFDNRTNVVQSLDLYQKTIQFEKIDFEQYPIFKIAYDILKNPYTT
RGAVLTCINQHVVKLFQKQKINFLQITELISNFYWNYQHKKIDDIWQINDLIFKIKAAIS
SKYAYLDK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagtgcttggagcaactggatcaattggcaagcaaacaattgatgtgatc
tgccaactaaagtaccaattagttggtttttcttattatcaaaaccacaatgaagccaat
aatattcttaaacaattaaatcccaactatgttttatgtcatagtgatcccaaatacaat
aagaatgttaagagtgatttaattgagctaattgataaaagtaagcctaaagttattatt
aatgcaattaatggttatcatggaattgaagcttcattaattgcgcttagtaagaaaaaa
gatctcttgttagctaataaagaatcgttagtgattgctggatcacaactagaagcaatt
agaaaagatacgaaaacaacgatctatccgatcgattcagagcacagtgcactgtatgat
ttattaaaagataagaaaaaaaatcagattaaacaattaatgatcacagcatctggagcg
ggatattttaataaagatataagtgagcttagaaagctcacttataatgatctcttaaat
catcctaattggaagatgggtgcagagatctcgattaattcagctacgttcgtaaacaaa
gtttatgagattgttgaagcttatcatctttttaaaataaaagatattatccccgtggtg
gaaagaagttcgacaatccatgctggggtgatctatcaagataattcgattcattttcat
gcgacgaccaacgacatgcgttgagcgatccagtcagcactaaccaaatttgataataga
actaacgttgttcaatcgttagatctttatcaaaaaacgattcaatttgaaaaaattgat
tttgaacaatatccgatatttaaaattgcttatgatatattaaaaaatccctacacgaca
agaggagctgtactgacttgtattaatcaacatgtcgttaagttgtttcaaaagcaaaag
atcaattttttacagattactgaactgattagtaatttttattgaaactatcaacataaa
aaaattgatgacatttggcaaataaacgatttaatatttaaaattaaagcagcgatctca
agcaaatatgcttatttagataaataa

DBGET integrated database retrieval system