KEGG   Mycoplasma gallisepticum NC08_2008.031-4-3P: HFMG08NCA_4577Help
Entry
HFMG08NCA_4577    CDS       T02327                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mgan  Mycoplasma gallisepticum NC08_2008.031-4-3P
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgan03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(781709..782329)
Genome map
AA seq 206 aa AA seqDB search
MTSDLDLNEFNNLVEQISDLPSVSKKQAKKITQYLMTKSDRYVYDLIDVLKRAKLSIKIC
EMCQGWSNRSICSICSDESRNKNELCIVSFFDDLNVIEESQAYHGKYFILNHEISKKNKR
IIEEINFDLLLDLIKKQKIEKVIIATNFTQDGQTTANYLRFLLDDFDLKIYRLGMGLPYN
SSIDYADSFSLKGAFENKQLIKDKKA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagatctagatctgaatgagtttaataatctagtagaacagattagcgactta
ccaagtgttagtaaaaaacaagccaaaaagattacccaatacttaatgactaaatcagat
cgttatgtttatgatctgattgatgttttaaaacgagctaaattatctatcaagatctgc
gagatgtgtcagggttgatcaaatcgttctatctgtagcatctgttcggatgaatcaaga
aataagaatgaactgtgtattgttagtttttttgatgatttaaatgtgattgaagaatcc
caagcttatcatggtaagtattttattcttaaccatgagatctctaaaaagaataaaaga
atcattgaagagattaattttgatctattattagatctgattaaaaaacaaaaaattgag
aaggtaattattgcgactaattttactcaagatgggcaaacaacagcaaattacttacgc
tttttattagatgattttgatcttaaaatctatcgtttaggtatgggtttaccatacaat
tcttcaattgattatgctgattcctttagtttaaaaggtgctttcgaaaacaaacagcta
ataaaagataaaaaagcgtaa

DBGET integrated database retrieval system