KEGG   Mycoplasma genitalium M2321: CM9_00595Help
Entry
CM9_00595         CDS       T02209                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mgc  Mycoplasma genitalium M2321
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mgc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134746..135315
Genome map
AA seq 189 aa AA seqDB search
MNNQGRIFVITGPSGVGKSTLVKALLDHFKEQLFYSISATTRKKRISEKEGIDYFFKDKD
EFENLIKQDAFIEWACYNNHYYGTLKSQAEQAIKSGINLMLEIEYQGALQVKSKYPHNVV
LIFIKPPSMQELLKRLKKRNDEDETTIKKRLEQAKIEFQQIDNFKYVVTNKEFDKTLNEL
KSILLSEFI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatcaggggagaatttttgtcattactggtcctagcggtgttggcaaaagcacc
cttgttaaagccttattagatcatttcaaagaacaactgttctacagtatctctgcaact
acaagaaaaaagcgcattagtgaaaaagagggaattgattatttttttaaagataaagat
gagtttgaaaacttaataaaacaagatgctttcattgaatgggcttgctataataaccat
tattatggaacgctcaagtctcaagctgaacaagcaattaaaagcggaattaatttaatg
cttgaaattgagtatcaaggtgctttacaggttaaaagtaaatatcctcataacgttgtt
ttaattttcattaaaccaccttcaatgcaagagttgttaaaacgtttaaaaaagcgtaat
gatgaagatgaaaccacaattaaaaaacgtttagaacaagctaagatagagtttcaacag
attgataattttaagtatgttgtcactaacaaagagtttgataaaacccttaatgagttg
aaatcaatcttactatctgagtttatttaa

DBGET integrated database retrieval system