KEGG   Mycoplasma genitalium M2321: CM9_01360Help
Entry
CM9_01360         CDS       T02209                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgc  Mycoplasma genitalium M2321
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CM9_01360
   00670 One carbon pool by folate
    CM9_01360
Enzymes [BR:mgc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CM9_01360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274591..275073
Genome map
AA seq 160 aa AA seqDB search
MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESLPKVFEKRTIF
LLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFICGGKSVYEQTINECDQLIVS
IIKKKYKGDQFLKVDLSKFVLNEVVEFEEFNVNYYRKKQQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctaattgctatctgagcgatgacacaagaaggactaataggtaataacaacacttta
ccttggatgattaaacaagagctagctcactttaaaaaaactacgttatttcaagctttg
ttaatggggagaaaaacttacgaatcactccccaaggtatttgaaaaaagaacaatattt
ctcctttcaaaagatcaaaactaccgttttgaagaaaagggaagtgaagtgaaagttatt
aatgatttttgaccactaattaaaagttaccaagcaaataaagaaaaggatttgtttatt
tgtggtggaaaaagtgtgtatgaacagaccattaatgaatgtgatcagttaattgtttca
atcattaaaaagaagtataagggtgatcagtttttgaaggttgatctcagtaaatttgta
cttaatgaagttgtagagtttgaggaatttaatgttaattattatagaaagaaacaacaa
taa

DBGET integrated database retrieval system