KEGG   Mycoplasma genitalium M2321: CM9_01620Help
Entry
CM9_01620         CDS       T02209                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgc  Mycoplasma genitalium M2321
Pathway
mgc00010  Glycolysis / Gluconeogenesis
mgc00020  Citrate cycle (TCA cycle)
mgc00620  Pyruvate metabolism
mgc01100  Metabolic pathways
mgc01110  Biosynthesis of secondary metabolites
mgc01120  Microbial metabolism in diverse environments
mgc01130  Biosynthesis of antibiotics
mgc01200  Carbon metabolism
Module
mgc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM9_01620
   00020 Citrate cycle (TCA cycle)
    CM9_01620
   00620 Pyruvate metabolism
    CM9_01620
Enzymes [BR:mgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CM9_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFQ03106
Position
complement(329756..330910)
Genome map
AA seq 384 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKQVGDQIKIDEALFVVETDKVTTELPSPFAGTISAIN
VKVGDVVSIGQVMAVIGEKTSTPLVEPKPQPTEEVAKVKEAGASVVGEIKVSDNLFPIFG
VKPHATPAVKDTKVASSTNITVETTQKPESKTEQKTIAISTMRKAIAEAMTKSHAIIPTT
VLTFYVNATKLKQYRESVNGYALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNE
IVLNDDINVGIAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGT
ISVTNFGSLGAAVGTPIIKYPEMCIVATGNLEERIVKVENGIAVHTILPLTIAADHRWVD
GADVGRFGKEIAKQIEELIDLTVA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaaattcactgatgttggtgagggtttacatgaaggaaaagtaact
gaaatcttaaaacaagttggtgatcagatcaagatagatgaagctttatttgttgttgaa
actgataaagttacaactgaactaccttctccttttgcaggtacaattagtgctattaat
gttaaagttggtgatgttgttagcattggtcaggtgatggcagttattggtgaaaagact
agtacaccacttgttgaaccaaaacctcaaccaactgaagaagtagctaaggtaaaagaa
gcgggggcttcagtagtaggggaaattaaggtttctgataacctctttcctatctttgga
gtaaaacctcatgcaactccagctgttaaagacactaaagttgcaagtagtactaacatt
actgtagaaacaacccaaaaaccagaaagtaaaactgaacagaaaaccattgctatctca
acaatgcgtaaagcgattgcagaagcaatgacaaagtcgcacgcaattatcccaaccact
gtattaactttttatgttaatgcaaccaagttaaaacaatatcgtgaaagtgttaatggt
tatgctttaagtaagtattccatgaaaatttcttactttgctttctttgttaaagcaatt
gttaatgcgcttaagaagttccctgtttttaacgctagttatgatcctgatcaaaacgaa
attgttttaaatgatgacattaatgtaggaattgctgttgatactgaagaaggtttaatt
gtccctaacattaagcaagcccaaaccaaatctgtggttgaaattgcccaagcaattgtt
gatttagctaacaaagctagaacaaaaaagattaagttgactgatttgaataaaggtact
atttcagttactaacttcggttcattaggagcagctgtaggtacacctattattaagtac
cctgagatgtgtattgttgctactggtaatttagaagaacgcattgttaaagtggaaaat
ggaattgcagttcataccatcttacctttaacaatagctgcagaccaccgctgggttgat
ggggcggatgttggtaggtttggtaaggagattgcaaaacaaattgaggaattaattgat
cttacagtagcttaa

DBGET integrated database retrieval system