KEGG   Mycoplasma genitalium G37: MG_027Help
Entry
MG_027            CDS       T00002                                 

Gene name
nusB
Definition
(GenBank) transcription termination/antitermination protein NusB
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
30093..30548
Genome map
AA seq 151 aa AA seqDB search
MAITVKGLTNKLTRTQRRIAVVEFIFSLLFFLPKEAEVIQADFLEYDTKERQLNEWQKLI
VKAFSENIFSFQKKIEEQQLKNQLEIQTKYNKISGKKIDLLTTAVVLCALSEQKAHNTDK
PLLISEALLIMDHYSQGAEKKQTHALLDKLL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaccgtgaaaggtttaacaaataaattaactagaacccaaagacgaattgct
gtagtggaatttatcttttctctcctctttttcttacctaaagaagctgaagttattcaa
gcagattttttagagtatgatactaaagaacgacaactaaatgaatgacaaaaactaatt
gttaaagcatttagtgaaaatatcttctcttttcaaaagaaaattgaagaacaacaattg
aaaaatcaattagaaattcaaactaaatacaataaaatatcaggaaaaaagattgatctt
ttaactactgcagttgttttatgtgcacttagtgaacaaaaggcacataatactgataaa
ccacttttaattagtgaggcattgttgattatggatcattattcacaaggtgctgaaaaa
aaacaaactcatgctttattagataagctcttgtaa

DBGET integrated database retrieval system