KEGG   Mycoplasma genitalium G37: MG_028Help
Entry
MG_028            CDS       T00002                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
30548..31153
Genome map
AA seq 201 aa AA seqDB search
MKRNWRQHYNVFLANLVLVFGFALNILVAKQSLNNTTPQFRFLFVTPFLGVVIGAVLYFF
DVKWFLIDYPYKKFHFQKKWAIVYLSGVIVFFLNVLIGVVLLVVMVNYITNQILEREYER
LFTNSLPYLWSTTGTSIVLSLISIGMSKTAHFFIDIEILKAKKGEPTDPNKTDNRAVVIN
LDENKKNEKEQSPPSAEMTSL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaactgaagacaacactataatgtttttttagctaatctagttttagtattt
ggctttgctttaaatattttggttgcaaaacaatctttaaataacacaacgccccagttc
aggtttttgtttgtaactccttttcttggcgttgtcataggtgctgttctctattttttt
gatgttaagtggtttttaattgactatccatacaagaaatttcactttcaaaaaaaatga
gcaattgtttatttatcaggggttattgtattttttttaaatgttttaattggagtagtt
ttacttgttgtaatggttaattacattactaaccaaattcttgaaagggaatatgaaaga
ttatttacaaattcattaccttatttatgatcaacaacaggaactagtattgttttaagt
cttattagtataggaatgagtaaaactgcacatttttttattgatatagagattttgaaa
gccaaaaaaggagaacccactgatcctaataaaactgataatagagcagttgttattaat
cttgatgagaataaaaagaatgaaaaagaacagtcccctccttctgcagaaatgactagt
ctttaa

DBGET integrated database retrieval system