KEGG   Mycoplasma genitalium G37: MG_029Help
Entry
MG_029            CDS       T00002                                 

Definition
(GenBank) DJ-1/PfpI family protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(31143..31703)
Genome map
AA seq 186 aa AA seqDB search
MKKILVIVYPEMNDVEYTNVMVVFSFIKTIQTTCYHHSLKKITASNGVVEVNNIVNTINL
SEFDAVYIPGGIGATKHLDKDEKLLKTINYFKVNNLYLFAICDTPNVLFKHGIITKDEIY
SSFPNPNLVMSENRSTAKVTVANKLITARSAGCALEFATVIVCTFLKDNTLNELVHKRLF
GSEIKD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatacttgttattgtctatccagagatgaatgatgttgaatatactaatgta
atggttgtatttagtttcattaaaacaatacaaacaacatgttatcaccattcattaaaa
aagataactgctagtaatggtgttgttgaagttaacaatattgtcaacaccattaactta
tcagaatttgatgcagtttatattcccggtggaataggagctacaaaacacttagataaa
gatgaaaaactgcttaaaacaattaattatttcaaagtaaataacctttatctttttgct
atttgtgacacaccgaatgttctatttaaacatggtattatcactaaagatgagatctat
tcttcttttccaaacccaaatttagttatgtctgaaaacagatcaacagcaaaagtaaca
gtagcaaataaattaataacagcaagaagtgctggttgtgctttggaatttgcaacagtt
attgtgtgcacttttttaaaagataacactttaaatgagcttgttcataaaaggttattt
ggtagtgaaattaaagactag

DBGET integrated database retrieval system