KEGG   Mycoplasma genitalium G37: MG_036Help
Entry
MG_036            CDS       T00002                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mge  Mycoplasma genitalium G37
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MG_036 (aspS)
Enzymes [BR:mge01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     MG_036 (aspS)
Amino acid related enzymes [BR:mge01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   MG_036 (aspS)
Transfer RNA biogenesis [BR:mge03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MG_036 (aspS)
 Prokaryotic Type
   Other AARSs
    MG_036 (aspS)
Mitochondrial biogenesis [BR:mge03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MG_036 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
41776..43428
Genome map
AA seq 550 aa AA seqDB search
MCFNQRILIGSISTEQLNKTIVIIGWIKRIKKLGEINFIIVGDKSGTIQVTCKDKEQIQQ
LTREDIVIVKAKLQRLDSVRFELINPTIKLFSKSKTPPLIIEDETDALEEVRLKYRYLDL
RRRLMQKRLLLRHQFILAIRNWFNQQGFIEIETPTLSKSTPEGAQDFLVPARIRKDCFYA
LVQSPQIYKQLLMIAGVEKYFQIARVYRDEDSRKDRQPEHTQIDFEISFCNQKMIMNLVE
KLFFSVFLDVFQIKIKKTFPVFKFSELFERFGSDKPDLRYGFEIKDFTSLFQDHQNQFTK
LIEAKGIIGGIELTNIELSTDKIKALRKIAKDHDVSLEVHNKNNSTLKTSIKCDEKNTLL
LVANKSKKKAWTALGAIRNELKYHLDIVKPNQYSFCWVVDFPLYDFDEKTNQWISNHNIF
SKPKQEWIDNFESNKNEALSEQFDLVLNGFEIGSGSIRINDPIVQKRLMNSLNIDPNKFA
FLLEAYQYGAPVHGGMGLGIDRLMMILNQTDNIREVIAFPKNNHGIEVHTNAPDKIDKEE
VKWWIKELVK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttaaccaacgaattttaattggctcaatttcaactgaacaactcaataaaaca
atagttattattgggtgaattaaacggattaaaaagttaggtgaaattaactttattatc
gttggtgataaatcaggaactatccaagtaacttgcaaagataaagaacagattcaacaa
cttacaagagaagacatagttattgttaaagccaaattacaacgcttagatagtgttaga
tttgaactgataaatccaactattaaacttttttcaaagtcaaaaactcctcctttaatt
attgaagatgaaactgatgctttagaagaagttaggttaaaataccgttaccttgatctg
agaagacgtttgatgcaaaaacgattgttattgcgtcatcaatttatattagcaattcgt
aactgatttaaccagcagggttttattgaaatagaaacacctaccttatccaaatcaact
cctgagggagcacaagactttttagttcctgcaagaattagaaaagattgtttttatgct
ttagttcaaagtccacaaatctataagcagctcttaatgattgcaggagttgaaaaatat
tttcaaattgcaagggtctatcgtgatgaagatagcagaaaagatcgtcaaccagaacac
acacaaattgatttcgagatctctttttgtaaccaaaaaatgattatgaatctagttgaa
aaactcttttttagtgttttcttagatgtttttcaaatcaaaataaaaaagacttttcct
gtttttaaattttcagaactttttgaaagatttggtagcgataaaccagatttacgttat
ggttttgaaataaaagatttcacctcgctttttcaagatcatcagaatcagttcactaaa
ttaattgaagcaaaaggcattattggtggtattgaacttactaatattgagttaagtaca
gacaaaattaaagcattaagaaaaattgctaaggaccatgatgtgagtttagaagttcat
aataaaaataattcaacattaaaaacttcaattaaatgtgatgaaaaaaacactcttctg
ttagtagcaaataaatctaaaaagaaggcatgaactgctttaggagcaattagaaatgag
ttgaaataccacttggatattgtcaaacctaaccaatacagcttttgttgagttgttgat
ttccctctctatgattttgatgagaaaacaaatcagtgaatatcaaatcacaacatcttt
tcaaaacctaaacaagaatgaattgataattttgaatcaaataaaaacgaagcattaagc
gaacagtttgatcttgttttaaatggttttgaaattggtagtggttcaataagaattaat
gatccaattgttcaaaaaagactaatgaattctttgaacattgacccaaataagtttgct
tttcttctagaagcttatcaatatggtgctcctgttcatggtggaatgggactaggtatt
gatcgtttaatgatgattcttaatcaaactgataacatcagagaagtaatcgcttttcct
aagaataatcatggtattgaagtccatacaaacgctcctgataaaattgacaaagaggag
gttaaatgatggataaaagaactagtgaaatag

DBGET integrated database retrieval system