KEGG   Mycoplasma genitalium G37: MG_040Help
Entry
MG_040            CDS       T00002                                 

Definition
(GenBank) lipoprotein, putative
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
47580..49355
Genome map
AA seq 591 aa AA seqDB search
MGKLLFGKLVFKKSLFLLSGMSSLAVFLTACGATKIFDSSVQLLVSDNFSTLADKSFSQM
SYEGIRSFFKKSKGVDLPEADSSQLQEGNGLWKRPGFTLSDRIATFNNIKNDGSDVIVAT
GFNQQESLQAITSDDIRFQSDKESLAKTGFIFVDGAIEKEFNKRNGVPQFKSTPTNISSV
AFRSDDGSFLTGVATAVYLNLNQEYFLDKSGWSTNSSNNNELTVSGFVGIALPSTLSFLN
GFRLGIAYFNEVIYKHLSDAQDSSAQVTTSKQTVLKQLQVANGEKRIKKIKWISPKQGSD
GETINIQDHQSGSFSDTEPRAITIANNLIDKGVNAIIPIAGPQTNLVVTQIARRQAHTAV
IGVDSAQELLDINIDAPNKDKLKMGNKKIIPFSSIKALDVAVESILSTLEKGSSQNGYQG
FGYNNIGTVKNNSVGVSEAGYEFLIDPVFWKNTSSMQAMSLSASLKANAASSSDNKKKLS
EVATKKNENGSTKNGSNDIIDKYAKLLTKSSSSTSMRNGSSDSNQQNFKTTDNDGDWTIV
GDELGKYKSSELPIFTGSSSYPTFQTEAQNVLDGGANVASTQGFKWSFKQI
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagctattatttggtaagttagtttttaaaaagagcttgtttttactgagtggt
atgagcagtttagcagtttttttaactgcatgtggggctaccaaaatatttgattcctct
gtacagctattagtgtcagataacttttccacacttgctgataaatcattttcacaaatg
tcctatgaaggaatcaggagcttttttaaaaaaagtaagggtgttgatttacctgaagca
gatagttcacaattacaagaaggcaatggcttgtgaaaacgtcctggttttacattaagt
gatagaattgctacttttaataacatcaaaaatgatggctctgatgttattgttgcaaca
ggttttaaccaacaagaatcacttcaagcaattacttctgatgacattaggtttcaaagt
gataaagaaagcttagctaaaacaggttttatttttgttgatggagctattgaaaaggag
tttaataaaagaaatggtgttcctcaatttaagtcaactcctaccaatatctcatcagtt
gcttttagaagtgatgatggttcttttttaactggagttgctactgcagtttacttaaat
cttaaccaagaatatttccttgataaaagtggttggtcaactaatagtagtaataataac
gaactaactgtaagtggttttgtaggtattgctctaccttcaacgctttcttttctaaat
ggttttcgactaggtattgcttattttaatgaagtgatttataaacatttaagcgatgca
caagattcatctgcacaagtgaccacttctaaacaaactgttttaaaacaacttcaagtt
gcaaatggtgaaaaaaggattaaaaagattaaatggatttcaccaaaacaaggaagtgat
ggagaaactataaacattcaagatcaccaatcaggttctttttcagatactgaacctaga
gcaataacaatagctaataatttaattgataaaggagttaatgctatcattcctattgct
ggaccacaaacgaatttagtggttactcaaattgctagaagacaagcccatactgcagtt
attggcgttgatagtgcacaggaattgctagatattaatattgatgctccaaataaagat
aagttaaaaatggggaataaaaagattattcccttctcttctattaaggctttggatgtt
gctgttgaaagtatcttatcaacattagaaaaaggttccagccaaaatggttatcaaggc
tttggatataacaacataggtacagtgaaaaacaactctgttggggttagtgaagcaggt
tatgaatttttaatagatcctgttttttgaaaaaatactagttcaatgcaagctatgtct
ttatcagcaagtctaaaagctaatgcagcatcttcatcagataataagaaaaaattatca
gaagttgctactaagaaaaatgaaaacggttcgacaaaaaatggtagtaatgacatcatt
gacaaatatgccaaactcttaacaaaatctagttcttcaactagtatgagaaacggtagt
tcagatagcaatcaacagaattttaaaacaacagataatgatggtgattgaactattgtt
ggtgatgaattaggtaaatataagtctagtgaactgcctatttttacaggtagttcttca
tacccaacttttcaaactgaagcacaaaatgttttagatggtggagcgaatgttgcttca
acacaaggctttaaatgaagctttaaacaaatttag

DBGET integrated database retrieval system