KEGG   Mycoplasma genitalium G37: MG_041Help
Entry
MG_041            CDS       T00002                                 

Definition
(GenBank) phosphocarrier protein HPr
  KO
K11189  
phosphocarrier protein
Organism
mge  Mycoplasma genitalium G37
Brite
Transporters [BR:mge02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    MG_041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
49376..49642
Genome map
AA seq 88 aa AA seqDB search
MKKFQAVIKDPVGIHARPASILASEASKFKSELKLVAPSGVEGNIKSIINLMSLGIRHND
NITIKADGADEEEALAAIKACLEKNKVI
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttcaagcagttattaaagacccagtgggaattcacgcacgtcctgcttct
atccttgcaagtgaggctagtaagtttaaatctgaacttaaactggtagctccaagtggt
gttgaaggtaatattaaatcaattattaacttaatgtctttaggaattagacataatgac
aacattactatcaaagcagatggagctgatgaagaagaagctttagcagctattaaagct
tgtcttgaaaaaaataaagttatctaa

DBGET integrated database retrieval system