KEGG   Mycoplasma genitalium G37: MG_042Help
Entry
MG_042            CDS       T00002                                 

Definition
(GenBank) spermidine/putrescine ABC transporter, ATP-binding protein, putative
  KO
K11072  
spermidine/putrescine transport system ATP-binding protein [EC:3.6.3.31]
Organism
mge  Mycoplasma genitalium G37
Pathway
ABC transporters
Module
Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:mge00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    MG_042
Enzymes [BR:mge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.31  polyamine-transporting ATPase
     MG_042
Transporters [BR:mge02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299] [OT]
    MG_042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
49840..51519
Genome map
AA seq 559 aa AA seqDB search
MNEHSLIEIEGLNKTFDDGYVSIRDISLNIKKGEFITILGPSGCGKTTLLRLLAGFEDPT
YGKIKVNGIDIKDMAIHKRPFATVFQDYALFSHLTVYKNIAYGLKVMWTKLDEIPKLVSD
YQKQLALKHLKLERKIEQLQKNNSNAQRIKKLKEKLQKLLEINKQKVIEFENKEKLRRED
IYKNLEQLTKEWDLLSQKKLKEVEQQKQAIDKSFEKVENKYKKDPWFFQHSEIRLKQYQK
KKTELKADIKATKNKEQIQKLTKELQTLKQKYANKKAIDKEYDKLVVAYNKKDYWTSYWE
TYTLQQKEAFEKRYLSRKLTKAEQNKKVSDVIEMVGLKGKEDRLPDELSGGMKQRVALAR
SLVVEPEILLLDEPLSALDAKVRKNLQKELQQIHKKSGLTFILVTHDQEEALVLSDRIVV
MNEGNILQVGNPVDIYDSPKTEWIANFIGQANIFKGTYLGEKKIQLQSGEIIQTDVDNNY
VVGKQYKILIRPEDFDLVPENKGFFNVRVIDKNYKGLLWKITTQLKDNTIVDLESVNEVD
VNKTFGVLFDPIDVHLMEV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgaacattctttaattgaaattgaaggtttgaacaagacctttgatgatggttat
gtttctataagagacattagcctaaatattaaaaaaggcgaatttattactattttaggc
ccttctggttgtggtaaaactaccctgttgaggttattagctggatttgaagatcctact
tatggcaagatcaaagttaatggtattgacattaaagacatggcaatccataagcgtcct
tttgcgacagtttttcaagactatgctttattttcccatctaactgtttataaaaacatt
gcttatggtctgaaggtaatgtgaacaaagttagatgaaattccaaaacttgtaagtgat
tatcaaaagcaacttgctcttaagcatttaaagctagaaagaaaaatagagcagttacaa
aaaaacaattctaatgctcaaagaataaagaaattaaaggaaaaattacaaaaactttta
gaaattaacaaacaaaaagttattgagtttgaaaataaagaaaaactacgtagagaagat
atttacaagaatttagagcaattaacaaaagaatgggatctactttctcaaaagaaacta
aaagaagttgaacaacaaaaacaagcaattgataaaagttttgaaaaagtagagaataaa
tacaaaaaagatccttggttttttcaacacagtgaaatacgtttaaaacaatatcagaag
aaaaaaactgagttgaaagctgatattaaagcaacaaagaacaaagaacaaatccaaaaa
ttaactaaagaacttcaaaccttaaaacaaaaatacgctaataaaaaagcaattgacaaa
gagtatgacaaattagttgtagcttacaataagaaagactattgaacttcttattgagaa
acatacacacttcaacaaaaagaagcttttgaaaaacgttatctttcaagaaaactaact
aaagctgaacaaaataaaaaagttagtgatgttattgaaatggttggtttaaaaggtaaa
gaagatcgtttgcctgatgaattatcagggggaatgaaacaaagagttgctttagcacgt
tctttagtagtagaacctgaaattcttttattagatgaaccattatctgcacttgatgca
aaggttagaaagaatttacaaaaagaattacaacagattcataaaaaaagtggattgact
tttatcttagtaactcatgatcaagaagaggctttagttttatcagatcggatagtggtt
atgaatgagggaaacatcttacaagttggtaatcctgttgatatttatgactctcctaag
actgaatgaattgctaatttcattggtcaagctaacatctttaaaggtacttatttagga
gaaaaaaagattcagttacagagtggtgaaatcattcaaactgatgttgataataactat
gttgtaggtaagcaatataagatcttaattcgtcctgaagactttgatcttgttcctgaa
aataaaggtttttttaatgttcgtgttattgataaaaactacaaaggattgctttgaaag
ataaccacacaattaaaagataacactattgttgatttggagagtgttaatgaagttgat
gtaaataagacctttggtgttttatttgatcctatagatgttcatttaatggaagtttaa

DBGET integrated database retrieval system