KEGG   Mycoplasma genitalium G37: MG_045Help
Entry
MG_045            CDS       T00002                                 

Definition
(GenBank) spermidine/putrescine ABC transporter, spermidine/putrescine binding protein, putative
  KO
K11069  
spermidine/putrescine transport system substrate-binding protein
Organism
mge  Mycoplasma genitalium G37
Pathway
ABC transporters
Module
Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:mge00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    MG_045
Transporters [BR:mge02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299] [OT]
    MG_045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
53204..54655
Genome map
AA seq 483 aa AA seqDB search
MKKQLKYCFFSLFVSLSSILSSCGSTTFVLANFESYISPLLLERVQEKHPLTFLTYPSNE
KLINGFANNTYSVAVASTYAVSELIERDLLSPIDWSQFNLKKSSSSSDKVNNASDAKDLF
IDSIKEISQQTKDSKNNELLHWAVPYFLQNLVFVYRGEKISELEQENVSWTDVIKAIVKH
KDRFNDNRLVFIDDARTIFSLANIVNTNNNSADVNPKEDGIGYFTNVYESFQRLGLTKSN
LDSIFVNSDSNIVINELASGRRQGGIVYNGDAVYAALGGDLRDELSEEQIPDGNNFHIVQ
PKISPVALDLLVINKQQSNFQKEAHEIIFDLALDGADQTKEQLIKTDEELGTDDEDFYLK
GAMQNFSYVNYVSPLKVISDPSTGIVSSKKNNAEMKSKQMSTDQMTSEKEFDYYTETLKA
LLEKEDSAELNENEKKLVETIKKAYTIEKDSSIRWNQLVEKPISPLQRSNLSLSWLDFKL
HWW
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagttaaaatattgctttttctcactttttgttagtctctcatcaatattg
agtagttgtggttcaacaacatttgtactagctaactttgaatcttatatttcgccctta
ttgctagaaagagtacaagaaaaacatcccttaactttcttgacttatcctagtaatgaa
aaactaattaatggttttgctaacaacacttattcagtagcagtagcatctacttatgca
gttagtgaattgatagaaagggatctattatcaccaatagattgaagtcagtttaatctg
aaaaaaagtagtagttcaagtgataaagtaaataatgccagtgatgcaaaggatttgttt
attgattcaattaaagagatcagtcaacaaaccaaagatagtaaaaacaatgaattactg
cattgagcagttccttattttcttcaaaacttagtgtttgtttatcgtggtgaaaaaatt
agtgaacttgaacaggaaaatgtttcatgaactgatgtaattaaagcaattgtgaaacac
aaagatcgctttaatgacaataggttagttttcattgatgatgctagaacgatcttttca
cttgctaacatcgttaatactaacaacaattcagctgatgttaatccaaaggaagatgga
attggttatttcactaatgtctatgaaagctttcaaagacttggattaacaaaatctaat
ttagatagtatctttgttaattctgattccaatattgtgatcaatgaattggcaagtggt
agaagacaaggaggaattgtttacaatggtgatgcagtgtatgctgcattgggcggtgat
ttacgtgatgaattgagtgaagaacagattcctgatgggaacaactttcacattgtgcaa
cccaaaatttccccagttgctttagatcttttggttatcaataaacaacaatctaatttt
caaaaagaagcacatgagatcatttttgatcttgctttggatggtgctgatcaaactaaa
gaacagttaattaaaactgatgaagaattgggtactgatgatgaagacttttacttaaaa
ggagcgatgcaaaactttagttatgtgaactatgtttcaccattaaaagtaatatctgat
ccaagtactggaatagtcagttccaaaaagaataatgctgaaatgaaaagtaaacaaatg
tcaactgatcaaatgactagtgaaaaagaatttgattattacactgaaacacttaaagca
ttattagagaaagaagatagtgcagaattaaatgaaaatgaaaaaaaactagttgaaacc
attaagaaagcttacactattgaaaaagatagttcaattcggtgaaaccaattggtcgaa
aaaccaatttctcccttacaacgtagtaatttatcgttatcttgattagactttaaatta
cactggtgataa

DBGET integrated database retrieval system