KEGG   Mycoplasma genitalium G37: MG_051Help
Entry
MG_051            CDS       T00002                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mge  Mycoplasma genitalium G37
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MG_051 (deoA)
Enzymes [BR:mge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MG_051 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
59740..61005
Genome map
AA seq 421 aa AA seqDB search
MNIINLINKKQRGKALNLAEINWFVNAVLNKTIADYQITAFLMAIWFKGMNPNELFLLTK
AMVDTGEIIKFNHHGKISVDKHSTGGIGDKVSLALVPILTSLGFSVAKLSGRGLGYTGGT
IDKLEAVGVKTELTDQQAQACLDKNDCFIIGQSKDIAPVDKVLYGLRDITGTVDSLPLIA
SSIMSKKLAVMNEYIFIDLKYGKGAFCKTKKIANELAKLMQSIAKSFKRKLSVKLSDMNQ
VLGKAVGNVIEVNEAVNFLKQDLDQVGQDFIDLMQTIVINILLETKQAKTKQKAIELYQD
VLTSKKAWNRFLSFIESQGGNVELFTQKEGFFKPKYKASIKAEKSGILHFTDPIDLAKIG
INLGAGRMKKTDQIDPMAGLFLMKKDNESVAVGDTVLNLYSSSPISNEYISAAQKTIIIN
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcattaatttaattaataaaaaacaacgcggaaaagctttaaatttagctgaa
atcaattggtttgttaatgctgttttaaacaaaaccattgctgattatcaaattactgca
tttttgatggctatttggtttaaagggatgaacccaaatgaactttttttattaacaaaa
gcaatggtggatactggtgaaattattaagtttaatcaccatggcaagattagtgttgat
aaacattcaactggtggtattggtgataaggtttctttagcattggttcctatcttaact
agtttaggatttagtgttgctaaattatcaggaagaggccttggttatactggtggaaca
attgataaattagaagcagttggagttaaaacagaattaactgaccaacaagcacaagca
tgtttagataaaaatgattgttttatcatcggacaaagtaaggacatcgcaccagttgat
aaagtactttatggtttaagagatattactggaacagttgatagtttgcctttaattgca
tctagtattatgtctaaaaagctagcagttatgaacgagtatattttcattgatcttaaa
tatggaaaaggtgccttttgtaaaactaagaaaattgctaacgaacttgcaaaactgatg
caaagtattgctaaaagttttaaaagaaagctgtctgttaaattaagtgatatgaatcaa
gtacttggtaaagctgttggcaatgtaattgaagttaatgaagctgttaactttctaaaa
caagatttagatcaagtaggacaagattttattgatttaatgcaaacaattgttattaac
attctacttgaaacaaaacaagcaaaaaccaaacaaaaggctattgaactttatcaggat
gttttaactagtaaaaaagcatgaaatcgctttttatcttttattgaatctcaaggagga
aatgttgaattatttactcaaaaagaaggtttttttaaacctaagtataaggcatctata
aaagctgaaaaaagtggtatactacattttactgatccaattgatttagctaaaattggg
attaatctaggggcaggtaggatgaagaaaacagatcaaattgatccaatggcagggtta
tttttaatgaaaaaagataatgagtctgtggcagttggagacactgtattaaacctgtat
agttctagtcctattagcaatgaatatatctctgctgctcaaaaaacaataattattaat
aaataa

DBGET integrated database retrieval system