KEGG   Mycoplasma genitalium G37: MG_052Help
Entry
MG_052            CDS       T00002                                 

Definition
(GenBank) cytidine deaminase
  KO
K01489  
cytidine deaminase [EC:3.5.4.5]
Organism
mge  Mycoplasma genitalium G37
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MG_052
Enzymes [BR:mge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     MG_052
CD molecules [BR:mge04090]
 non-CD molecules
  MG_052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
61014..61406
Genome map
AA seq 130 aa AA seqDB search
MKVNLEWIIKQLQMIVKRAYTPFSNFKVACMIIANNQTFFGVNIENSSFPVTLCAERSAI
ASMVTSGHRKIDYVFVYFNTKNKSNSPCGMCRQNLLEFSHQKTKLFCIDNDSSYKQFSID
ELLMNGFKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaatttagagtggataattaaacagttacaaatgatagttaaaagagcatat
actcccttttctaactttaaagttgcatgtatgattattgctaacaaccaaacttttttt
ggagttaacattgaaaattcttcctttccagtaactttgtgtgctgaaagaagcgccatt
gctagcatggttacaagtggtcataggaaaattgattatgtttttgtttacttcaatact
aaaaataagagtaactcaccctgtggaatgtgcagacaaaacttactggaattttcccat
caaaaaacaaagcttttttgtattgataatgatagtagttataaacaattttccattgat
gaattattaatgaatggttttaaaaagagctaa

DBGET integrated database retrieval system