KEGG   Mycoplasma genitalium G37: MG_055Help
Entry
MG_055            CDS       T00002                                 

Definition
(GenBank) preprotein translocase, SecE subunit
  KO
K03073  
preprotein translocase subunit SecE
Organism
mge  Mycoplasma genitalium G37
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    MG_055
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    MG_055
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MG_055
Secretion system [BR:mge02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   MG_055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(63989..64360)
Genome map
AA seq 123 aa AA seqDB search
MEKKLPFSFKKKEKLTAYDDASIHELHKQLKLRTEAKKSKDKERTKEKEKHESLAKEKKP
KLPFKKRIVNLWFGVDKEINKIVWVKGRQLIIIFLLILLVSGLMVGIFFGINQLLITLGI
FKN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaactgccttttagctttaaaaagaaggaaaagctaactgcttatgatgat
gcttcaattcatgagttacataaacagctcaaacttagaacagaagccaagaaaagtaaa
gataaggaaagaactaaagaaaaagaaaagcatgaaagtttagcaaaggaaaagaaaccc
aagcttccttttaaaaaacgaattgttaatttatgatttggagttgataaagagatcaac
aaaattgtttgagtaaaaggtagacaacttatcataatttttcttttaattttgctagtt
agtggactgatggtaggaatcttttttggtatcaatcaattgttaattacgttgggaata
tttaaaaattaa

DBGET integrated database retrieval system