KEGG   Mycoplasma genitalium G37: MG_060Help
Entry
MG_060            CDS       T00002                                 

Definition
(GenBank) glycosyl transferase, group 2 family protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
67650..68543
Genome map
AA seq 297 aa AA seqDB search
MKLSVIIPTYNCASFIEKAINSIVKNRPNDLEIEVLIIDDGSIDNTNKVIKKIQDQINNL
TLQYFYKSNGNWGSVINYVRNNKLAKGEWVTVLDSDDIFSKKTISIFQKYAQKQRYDAII
FDYYKCWKKFLWKIPTYARFRKEIKGELKKQTPFCIPLAKFFKNEVFYQLPKLRENVGFQ
DAIYTMHALQIANNVFHVSKAGGYYFFKRVGNSMSIPWHSSRFDIEVQICKDLIENNAQE
IALVHLLRLKFRNLVDDKKIKFTVKRDFCFSGFSWYSRLILSLMYNFWLKRYFNSSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatctgtaattatacctacttacaattgtgcatcatttattgaaaaagcaatt
aattcaattgttaaaaatagacctaatgatttggaaatagaagttttaattattgatgat
ggatcaattgacaatactaacaaagttattaagaaaattcaagaccaaattaataattta
actttgcagtatttttacaaaagtaatggtaactggggtagtgttattaattatgttaga
aacaataaactagcaaaaggggaatgagtaacagtattggatagtgatgacattttttca
aaaaaaacaatttctatttttcaaaaatatgcccaaaaacaaagatatgatgcgattatt
tttgactactataaatgctgaaaaaagtttttgtgaaaaattcctacctatgcaaggttt
agaaaagaaattaaaggtgaattgaaaaaacaaacacctttttgtattcccttagctaag
ttttttaaaaatgaggttttctatcaacttcctaaactaagagaaaatgttggttttcaa
gacgctatttatacgatgcatgcattacaaattgcaaataatgttttccatgtttctaaa
gctggaggatattacttttttaaaagggtaggtaactctatgagtatcccttgacacagt
tctaggtttgatattgaagtacaaatctgcaaggatctgattgaaaataatgcgcaagag
atcgctttagtgcatttacttcgtttaaaatttcgtaatttagttgatgataaaaagatt
aaatttacagttaaaagagacttttgttttagtggttttagttggtatagtaggttaatt
ttatctctgatgtataacttctgattgaaacgttatttcaacagttctgaataa

DBGET integrated database retrieval system