KEGG   Mycoplasma genitalium G37: MG_061Help
Entry
MG_061            CDS       T00002                                 

Definition
(GenBank) Mycoplasma MFS transporter
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(68522..70225)
Genome map
AA seq 567 aa AA seqDB search
MENKSQKKVSDLKLITLWIIVIFGYLLFVVEWFVIDRISGKPTGILTQSTTTLPQYSGWL
SSFFTENAGQIATSSTNWTITLLRAVGSILCGVVVLKFGYRYAVLIMMGIMCVCFPFLII
GDPLNGHNQLTLLRPLSDSVKTQLSSLSSNLQVGQLLGPVMINGKTMLADGTSVELIKGL
DGNSIGTAASITGYALFIIFRSTIAIGGTTLVVYTQPAIANLSSNRKKSILSNANLWGFN
IGIAVVFTPFLFEQVQQVASQYWVYIMTVMILVVFANLCLFLWFESKIDHIFPQKQTKEN
MSLTTQPKSIDILKNKTTWKLIGVYGIVLILIVNPLTPAWFSILQTVSPSGSNGLISTGV
YTTGLATLAIFWVIGYALGFVVFSPFNKTIYDKKRWMHFLLTANIVVLLIIIMFAATLGI
GSAAGFALISIFSFIGGAFAWSLSSSNLILPYEFKDYKKNELPILFGFCWGFGYIAYTLF
DITQSVFLQAPVLIQGKGTSILPGVIVSIVFFLGLIALANLIVKFFPACWIKDGDQLVQE
MTRKWKLNEWQFVIANKQKNRYSELLK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaataaaagtcaaaaaaaagtaagtgatctgaaacttattaccctgtggatcata
gtaatttttgggtatctattgtttgtagttgaatggtttgtaattgatcgaattagtggt
aaaccaactggtatacttactcaatcaaccaccactttaccacagtacagtggttggtta
agttctttctttactgaaaatgctgggcaaatagccacatcttccaccaactgaactatc
actttattgagagcagtaggttctattctttgtggagttgttgttttgaaatttggttat
cgttatgcggttttaatcatgatgggaatcatgtgtgtttgttttccctttcttattata
ggagaccctttgaatggtcataatcaattaactttattaagacctttatcagattcagta
aaaactcaattaagttcactaagtagcaatttacaagtgggtcaattacttggaccggtg
atgatcaatggtaaaacgatgcttgcagatggaacaagtgttgaacttattaagggtttg
gatggtaatagtattggtacagctgcatcaattactggttatgcattgtttattatcttt
agaagcacaattgctattggtggaactaccttagtagtttatactcaaccagcaattgct
aatctttcttcaaacagaaaaaaatcaatcctatctaatgctaacctttggggttttaac
attgggattgcagtagttttcacaccgtttttatttgaacaagttcaacaagtagcctct
caatactgggtttacattatgactgtgatgattttggttgtgtttgctaacttatgttta
tttttatggtttgaaagcaagatagatcacatctttcctcaaaagcaaactaaggaaaat
atgagtttaactactcaaccaaaatccatagatatcttaaagaataaaacaacatgaaaa
ttaattggtgtttatggcatagttttaatactaatagtcaatccgttaactccagcttga
tttagcatcttgcaaactgtttccccatcaggatcaaatggtttgataagtactggtgtg
tacacaacaggtttagcaacacttgctattttttgagttattggttatgctttgggcttt
gttgttttttcaccatttaataaaaccatttatgacaagaagaggtgaatgcacttctta
ttaacagctaacatagtggtattgcttataatcatcatgtttgcagcaacacttggtatt
ggtagtgcagctgggtttgctttaattagtatcttttcatttatcggtggtgcatttgct
tggagtttatcaagttcaaatttaatcctgccatatgaatttaaagattacaagaagaat
gaacttcctattctttttggattttgttggggctttggttatattgcttacaccttattt
gacattacccaatcagtatttctccaagcgcctgttttaattcaaggaaaaggtacaagt
attttaccaggggtaattgtaagtattgttttcttcttaggacttattgcactagcaaac
ctaattgttaagttctttcctgcttgttggattaaagatggtgatcaattggttcaggaa
atgacaagaaaatgaaaactcaatgaatgacagtttgtaattgcaaataagcaaaaaaat
cgttattcagaactgttgaaataa

DBGET integrated database retrieval system