KEGG   Mycoplasma genitalium G37: MG_072Help
Entry
MG_072            CDS       T00002                                 

Gene name
secA
Definition
(GenBank) preprotein translocase, SecA subunit
  KO
K03070  
preprotein translocase subunit SecA
Organism
mge  Mycoplasma genitalium G37
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    MG_072 (secA)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    MG_072 (secA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MG_072 (secA)
Secretion system [BR:mge02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   MG_072 (secA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
94535..96955
Genome map
AA seq 806 aa AA seqDB search
MAIFNFLKLISPKNRILSKANRIASEVESYKNYYRNLTDQQLFEESNKLVDLVTKQNYTI
LDVCVAALALIREVVYRETGEFAYRVQIIGAFIVLSGDFAEMMTGEGKTLTIVLAAYVSA
LEKRGVHVVTVNEYLAQRDANNAMKILKRVGMSVGCNFANLSPQLKQAAFNCDVTYTTNS
ELGFDYLRDNMVHSYQDKKIRELHFAIVDEGDSVLIDEARTPLIISGPSKNEFGLYVAVD
RFVKSLTEQEFKIDPESRAASLTELGIKKAEQTFKKENLFALENSDLFHKIMNGLTAVKV
FEQGKEYIVRDGKVLIVDHFTGRILEGRSYSNGLQQAVQAKEYVEIEPENVIVATITYQS
FFRLYNRLAAVSGTALTESEEFLKIYNMVVVPVPTNRPNIRKDRSDSVFGTPQIKWMAVV
KEIKKIHETSRPILIGTANIDDSELLHNLLLEANIPHEVLNAKNHSREAEIVTKAGQKNA
VTISTNMAGRGTDIRLGEGVAEMGGLYVLGTERNESRRIDNQLRGRAARQGDKGETKFFI
SLGDSLFKRFAHDKIERAISKLGNETFDSAFFSKMLSRTQKRVEAINFDTRKNLIDYDHV
LASQRELIYKQRDKFLLANDLSEMIDKMLEKFVQQFCDQYRNQKNQNLINHIALAEALNL
EMNMQNTINPKVFENMTFDVAVDKTRNLVAKKISDKVNVLTKPIALNRFRDIIITSMDKH
WTEHLDSVFKLREGVVLRSMEHTSPLNVYIKETDILFKTMLQKIAQDVIVQIANLTTPDE
FDHSLMQANALKKLAAIKADEKSNQE
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcaatatttaacttccttaagttaatttcacccaaaaacagaattctcagtaaggca
aataggattgccagtgaggttgagagttataaaaactactaccgtaacttaactgatcaa
cagttatttgaagagtcaaataaactagttgatcttgtcactaagcaaaattacaccatt
ctagatgtttgtgttgctgcacttgctttaattagagaagtggtttaccgtgagactggt
gaatttgcatatagggtgcagatcataggagcttttattgttttaagtggtgattttgct
gagatgatgactggtgaaggtaagaccttaaccattgttttagcagcatacgtttctgca
cttgaaaagcgtggtgtgcatgttgttactgttaatgaatatctagctcaaagggatgct
aataatgcaatgaagatcttaaaacgggttgggatgagtgtcggttgtaactttgctaat
ctctcccctcagctaaaacaagctgcatttaattgcgatgttacctacaccactaacagt
gaactggggtttgattatcttagagataacatggtccacagttatcaagataagaagatc
agagagttgcactttgcaatagttgatgaaggtgattcagttttaattgatgaggcgcga
acgcctttaattatttcaggtcctagtaaaaatgagtttgggttatatgttgcagttgat
cgatttgttaaatcattaactgaacaggagtttaagattgaccctgaatcacgtgctgct
tctttaactgaacttgggattaaaaaagcagagcaaacatttaaaaaagaaaaccttttt
gctttggaaaacagtgatctttttcacaagatcatgaatggtttgactgctgtgaaagtt
tttgaacagggcaaagagtacattgttcgtgatggcaaggttttaattgttgatcacttt
acaggtaggatattggaagggagaagttacagtaatggcttacaacaagctgtacaagcc
aaagaatatgttgagatagaacctgaaaatgtgatagtagctaccattacctaccaatcc
ttctttaggctatacaaccgcttagcagcagtatcaggtactgctttaactgaatcagag
gagtttctcaagatttataacatggttgtagtaccagtgccaactaaccgtcctaacatc
agaaaagaccgttctgatagtgtatttggtaccccacaaattaagtgaatggcagttgtt
aaagagataaaaaagatccatgaaacttctcgacctattctgattggaactgctaacata
gatgattctgaactcttacataatctgttactagaagctaatattccccatgaggtttta
aatgctaaaaaccattcaagagaagcggagatagtaactaaagcaggacagaagaatgca
gttactatttcaactaacatggctggaagaggaactgatatccgtttaggtgaaggggtt
gctgaaatgggtggtctttatgtattgggaactgaaagaaatgagtcaagaaggattgat
aaccaactaagagggagagctgctagacaaggtgataaaggggaaactaagttctttatc
tcactaggtgattcattgtttaaacgttttgctcatgacaagattgaaagagcgattagc
aaattaggtaatgaaacatttgacagtgccttcttttccaaaatgttaagtagaacccaa
aaacgggtggaagcaattaactttgacactagaaaaaacctgattgattatgaccatgtt
cttgcaagtcaaagggaattgatttacaaacaacgtgataagtttttattagcaaacgat
ttaagtgaaatgatcgacaaaatgctagaaaagtttgtacaacagttttgtgatcaatat
agaaaccaaaagaaccaaaacttaattaatcacattgcactagcagaagctttaaatctt
gagatgaacatgcaaaacaccattaatccaaaggtgtttgaaaacatgacttttgatgtt
gctgttgataaaacccgtaacttagtagctaaaaagattagtgataaagttaatgttttg
accaaaccaattgctttaaacaggtttcgtgacattatcataacttcgatggataaacat
tgaactgaacacttggatagtgtttttaagttaagagaaggggttgtacttcgttctatg
gaacatacgagtcctttaaatgtttacattaaagaaacagatatcctttttaaaacaatg
ttgcaaaagattgctcaagatgtcattgtgcaaattgctaacctcacaactccagatgaa
tttgatcatagcttaatgcaagccaatgctttaaagaaactagcagcaattaaagcagat
gaaaaatcaaaccaagagtaa

DBGET integrated database retrieval system