KEGG   Mycoplasma genitalium G37: MG_073Help
Entry
MG_073            CDS       T00002                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  
excinuclease ABC subunit B
Organism
mge  Mycoplasma genitalium G37
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    MG_073 (uvrB)
DNA repair and recombination proteins [BR:mge03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     MG_073 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      MG_073 (uvrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
96933..98903
Genome map
AA seq 656 aa AA seqDB search
MKNQTKSNSLFQLSTNYIPTGDQPEAIKKLSEFKTKQQVLLGATGTGKTFTIANVIQNSQ
LPTVVIAHNKTLAGQLFNELKQLFPKNAVEYFISYFDFYQPEAYLPSKGIYIEKSATVNE
AIKRLRVSTLHSLSTRKDVIVVGSVASIYPTSSPSDFVKYCLWFVVGKDYDLKTIKDRLV
SLNYVVNKQQLTPGKFRFQGDVLEVFPGYSDAFVIRISFFDTKVEQICQIDPLTNKILNQ
LFEIKIGPADEYVVNQSDLDIAIKNIKQELQERVNYFNKQNLVERAQRLATITNHDLNDL
KAWGFCSGVENYARHLELRMANSTPYSIFDYFKGDWLLVIDESHQTLPQLNGMYNTDLSR
KQSLIDYGFRLPSALDNRPLSFAELQQKMQKVIYVSATPRDKEISLSQNNVIEQLVRPTY
LVDPIIVVKPKDNQVEDLIEEIINQRQNNTRTFVTVLTIKMAENLTEYLKERKIKVAYIH
KDIKALERLLLINDLRRGEYECLVGINLLREGLDVPEVALVCIFDADIPGLPRDERSLIQ
IIGRAARNEHGRVVMYANHVTEQMQKAIDETKRRRTVQMEYNKLHNKTPKTVVKPLTFVQ
PIKLKAKSNAEKNAALIKQLTKEMKKAAANQNYELAIEIRDSIFELEKEIGSKIKV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaccaagagtaatagtttatttcaactttccactaactatatacctact
ggtgatcaacctgaagcaattaagaaattatcagaatttaaaactaagcagcaggtttta
ttgggggccacaggcacaggtaaaacctttacaattgctaatgtaattcaaaacagccaa
ctcccaacagttgttattgctcataacaaaaccctagcaggtcaactcttcaatgaatta
aagcaactgtttcctaaaaatgcagttgaatattttatctcttactttgatttttatcaa
cctgaagcttacttacccagtaaagggatctacattgaaaaaagtgctacagtcaatgaa
gcgattaaacgcttaagagtctcaacactgcattcactttcaacaagaaaagatgttatt
gtagtaggttctgttgctagtatttatcccacctcatctcccagtgattttgttaagtat
tgcttgtggtttgtggttggcaaagattatgatttgaaaaccattaaagataggttagtt
agtcttaactatgttgttaataaacaacaattaaccccaggaaaatttcgctttcagggt
gatgttttggaggtatttcctggttacagtgatgcttttgtgatcagaatctcctttttt
gatactaaagtagaacaaatttgtcaaattgacccactaacaaataagattttaaaccaa
ctctttgagattaagataggtcctgctgatgaatatgttgtaaaccaatctgatcttgat
atagcaattaaaaatattaaacaagaacttcaggaacgagttaattatttcaataagcaa
aatcttgttgaaagagcacaacgtttagccaccattactaaccatgatctcaatgatctg
aaggcttggggattttgtagtggagttgaaaactatgctagacacttagagttgaggatg
gctaactcaaccccttacagtatctttgattattttaagggggattggttactggttatt
gatgaatcacaccaaactttaccgcaacttaatgggatgtataacactgatctttcaaga
aagcaaagcttaattgattatggttttcgactcccctctgcacttgataacagaccgctc
tcatttgctgaattacaacaaaaaatgcaaaaagttatttatgtttcagcaactccaaga
gataaagagattagtttaagtcagaataatgtcattgaacagttagttagaccaacttac
ttggttgatcctattatcgttgttaaaccaaaagataaccaggtggaggatctcattgaa
gagattatcaaccaacgccaaaacaacacaagaacatttgttactgttttaactattaag
atggctgaaaacctcactgaatacttaaaggaacgcaaaattaaagttgcctatatccat
aaggacattaaagcattggaacgtttattgttaattaatgacctgagaagaggtgaatat
gagtgtttagttgggattaaccttttaagagaagggttagatgtccctgaagttgcttta
gtttgtatctttgatgcagatatcccaggactacctagggatgagagaagtttaatccag
attattggacgtgctgctagaaatgaacatggtcgagttgttatgtatgctaaccatgtt
actgaacagatgcaaaaagccattgatgaaaccaaaagaagaagaactgttcaaatggaa
tataacaagctacataataagacaccaaaaacagttgttaaaccccttacctttgttcaa
ccaatcaaattaaaagctaagagtaatgcagaaaaaaatgctgcattaatcaaacaatta
accaaagaaatgaagaaagcagcagctaatcaaaattatgaacttgccattgagattaga
gattccatatttgaattggaaaaagaaattggtagtaaaattaaagtatag

DBGET integrated database retrieval system