KEGG   Mycoplasma genitalium G37: MG_075Help
Entry
MG_075            CDS       T00002                                 

Definition
(GenBank) 116 kDa surface antigen
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
99383..102457
Genome map
AA seq 1024 aa AA seqDB search
MKLSTITTICLSISGAFGTTAIALPTTVALLKNHQQQNTEKQQNPIKDIRFGLNNVQVPN
TIPLHQTVVEVTNNKAIVDYKDAPQKFFLAKSALNNKLQVEFDKFLLRTGVINALNADLK
EWIDQTLFIPNQSFFDLSANKLNLTLSNQSEVSLDLEFIFTNFSDKNQPLKLPFDGSVVV
NANESYTYSVKATLQKLKVLTYSRADHSVGISYAIPTVSLNGKTQNDFSFNPFKSNINFA
FKNVYNALNPFEAQQYLVGQGKFLNQKVNADDVKNDINNHIETQFNVAKITATLLGKAFK
QFGEHKNGQPLSLLKVLSGLNNEFKQLFNYVRPGLGDFVSDLIQSSSQSSNKKTVYQLLF
ENKTTIIHLLQDLNISELNSVLPVVDILFEGINSAESLYQRIQSFKDLIVPALKADKQLK
SLEAIILAVLDNPNTYVFDLVYQNKSILFNLLSDFLKNTANTLPFLQEQFDIVNHLFANE
AIFDLFSNADFVEKIADLFLAKQKVQEVNNDGTKSTKIVDSILVATLKGLVGDQLSSITE
LLNIYIFENEFLNRNDSNSSVKKQQTDSLKNLFSVIGDILSETNVNKITLHAVKNNELLS
LVETASTLKIKHLNVQYKVLVDKFELKNSFIKELLNFFPDTKDITPTIKKVLFESENYKT
LRKKYENEGFPGYHWAKFIVPGTFNSAENTFYSAIDKTKSIRDLFADMLFGKSLESVNDS
DSFIKINGSFTLKYHGDNLNLLPNYHSLITKNVGYQIVNVNFHIDARLLTAELQNTVFSN
PKPVIKSPVELSKSLFEVWKTIFENSVNQILKKEYTFKDNLKFFPFKADGSSRLEFDLSK
PDQRVIPFAFVDGYQFQLKKELIPNKETKKEANSSPVLKLYDAVKRNDRQYRPNHHHDDL
RNYPSLKSQLELILNLGDKLKANNDFIDDTVVNALQYKTSFKSTLKVNSLGIPINLFFFT
LWLKFNLEIPIDGSLTLTSVNVVFPYSLYDTSSNEFTRIVDRLNFTDTNFYLKDAFPNFW
FVGF
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacaataactactatctgcttgtcaatatctggtgcttttggtactact
gcaattgctttaccaactacagtagcattgttaaaaaaccaccaacagcaaaacactgaa
aaacaacaaaacccgattaaagatatccgctttggtttaaacaatgtacaggttccaaat
accattccgttacaccaaactgtggttgaagtgaccaacaacaaagcaattgttgattac
aaagatgcaccccaaaaattctttttagctaaaagtgcgttaaataataaactccaagtt
gagtttgataagttcttgttaagaacaggagtgattaatgctttaaatgcagatttgaaa
gaatggatagaccaaacattatttatccccaatcaaagtttttttgatcttagtgctaat
aaactcaatttaactttgtcaaatcaaagcgaagtgagtttagatcttgagtttattttt
actaactttagtgataaaaatcaaccattaaaactcccctttgatggtagtgtggtggtt
aatgctaacgagtcatacacctattcagttaaagcaacactacagaaactaaaagtattg
acttattcaagagcagatcattctgtagggattagttatgcaataccaacagtgagttta
aatggcaaaactcaaaatgactttagttttaacccctttaaaagtaatattaactttgct
ttcaaaaatgtctacaatgctttaaatccgtttgaagcacaacaatacctggttggccaa
ggtaagtttttaaaccaaaaagttaatgctgatgatgttaaaaatgacattaataatcac
attgaaacccagtttaatgttgctaaaatcacagcaactcttttaggaaaagcttttaag
cagtttggtgaacataaaaatggtcaaccactttcacttttaaaagtactaagtggatta
aacaatgagtttaaacaactctttaattatgtcagacctggtttaggtgattttgttagt
gatttaatccaaagctccagtcaatcaagtaataaaaaaactgtttaccagctattattt
gaaaacaagacaacaattatccacttgttgcaagatcttaatattagtgaactgaactct
gttttaccagttgttgatattttgtttgaagggattaacagtgcagaatcactataccaa
aggatccaatcatttaaggatttaattgttcctgctttaaaagctgataagcaacttaag
agcttagaagcgattattttagcagttttagacaatcctaatacctatgtttttgatctt
gtttaccaaaacaaatcgattctgtttaatttgttaagtgattttcttaaaaacaccgca
aacactttaccatttcttcaagaacagtttgatattgttaaccacttatttgccaatgaa
gcgatctttgatctgttttccaatgctgactttgttgagaagattgctgatcttttttta
gcaaaacaaaaggtacaagaagttaataatgatggaactaaatcaacaaaaattgttgat
tcgattttagttgctacccttaagggtttagttggtgatcagctcagttcaatcactgaa
ctgttaaacatctatatctttgaaaatgaatttttaaacagaaatgatagtaatagttca
gttaaaaaacaacaaactgatagtctaaaaaatctgtttagcgtaattggtgatatttta
agtgagaccaatgttaacaagatcactttacacgcagttaaaaataatgaacttctttcg
ttagttgaaacagcttcaacactaaaaattaaacatcttaatgttcaatacaaagtttta
gttgataagtttgaattgaaaaacagtttcattaaggaactattaaattttttcccagat
actaaagatatcaccccaactattaaaaaggtactgtttgaaagtgaaaattataaaaca
ctccgtaagaagtatgaaaatgaagggttcccaggttatcactgggctaagttcattgtc
ccaggtaccttcaattctgctgaaaacactttctattctgctattgataaaactaaatca
attcgcgatctgtttgctgacatgttatttggtaagagtttagagagtgttaatgacagt
gatagttttatcaaaattaatggttcatttacattaaagtaccacggtgataacttaaat
ttactccctaactaccactcattaatcactaagaatgttggttatcaaatagttaatgtt
aattttcatattgatgcaagattgctaactgcagaactacaaaacacggtattttcaaat
ccaaaaccagttattaaatcacctgttgaactctccaaatccttatttgaagtttgaaag
actatctttgaaaactcagttaaccaaatcttaaaaaaagaatatactttcaaagataat
ctaaagttctttccttttaaagctgatggctcctcgcgcttagaatttgatctatcaaaa
cctgatcaacgtgttattccttttgcttttgttgatggttatcaattccaactaaaaaaa
gagttaattcctaacaaagaaacaaaaaaagaagctaattcttcaccagttttaaagctt
tatgatgcagttaaaagaaacgatagacaatatcgtcctaatcaccaccatgatgatctg
agaaactatcctagccttaaatctcaactagaacttatattaaaccttggtgataagctt
aaagctaataatgattttatagatgacactgttgttaatgctttgcaatataaaactagt
tttaaatctactctaaaagttaacagtttaggaattcctattaaccttttctttttcaca
ttgtgacttaaatttaacttagaaattccaattgacggttcattaacattaacatccgtt
aatgttgttttcccatacagtttgtatgatactagttcaaatgaatttacaaggatagtc
gatcgcttaaatttcactgataccaacttctatctaaaagatgcatttcctaatttctgg
tttgttggtttctag

DBGET integrated database retrieval system