KEGG   Mycoplasma genitalium G37: MG_077Help
Entry
MG_077            CDS       T00002                                 

Definition
(GenBank) oligopeptide ABC transporter, permease protein (OppB)
  KO
K15581  
oligopeptide transport system permease protein
Organism
mge  Mycoplasma genitalium G37
Pathway
ABC transporters
Quorum sensing
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:mge00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    MG_077
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MG_077
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MG_077
Transporters [BR:mge02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    MG_077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
103104..104327
Genome map
AA seq 407 aa AA seqDB search
MFKYILKRLGLAVVAMFIVMSIVFFLVNATGNVPLSATSARDIAAVQAQLQEFGFNDPII
VRYFRYWAKLFSFQADALGIYYANPNQTIGEIVFARVPNTLYVVLISFLIGSLLGIFLGM
VSGLNRGKFLDAAINVLVVLFVSIPSFVVGLGLLKLAGFLNLPPRFINFDDAFFSFDRFL
LASIIPILSLVFYSSAAFTYRIRNEVVEVMNQDYIKTAKSKGLGMFAVARYHIFRNSIIP
SIPLFVFGISGAFSGGFIIESLFGVQGVSRILIDSVQVNETNMVMFNILFIQGIPLLASV
FIEFIYVLVDPRIRIANSSNVSLLTKLKFLSSRHQWLMKWNKINSDNAQNIVFNSPLHHQ
LLELNAIDYKTKTVQLTTEQKTALNISATANFILLGNKCLKLKTIHG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtatattcttaaacgattaggactagcagtagttgcgatgtttatcgtaatg
tctatagtcttctttttagtgaacgctactggtaatgttcccttgtcagccacttctgca
agagatattgctgcagtgcaagcacaactacaagagtttgggtttaatgaccctattata
gttaggtattttcgctattgagctaagctattttcctttcaagctgatgctttaggaatt
tattatgcaaaccctaaccaaacaattggtgagattgtgtttgcaagagtaccaaatacc
ttatatgtggttttaatctcttttttaattggttcattgctagggatctttttagggatg
gtttcaggattgaatagagggaagtttttagatgcagcaattaatgtgttggtagtttta
tttgtatctattccttcatttgtagtgggattagggttacttaaactagcaggattttta
aatctaccaccacggtttattaactttgatgatgctttttttagctttgatcgtttcttg
cttgcatcaattatcccgatcctttcattggtcttctattcatcagctgcttttacatac
aggattagaaatgaggtggtggaagtgatgaatcaagactatattaaaactgcaaaaagt
aagggacttgggatgtttgctgtagctaggtatcatatctttagaaactcgattattcct
tctattcccttgtttgtatttggaatctcaggtgctttttcaggtggatttattattgag
tctttgtttggagtacaaggggtatctaggatcttaattgattcagtgcaagttaatgaa
actaacatggtaatgtttaatatcttgtttatccaagggattcccttattagcaagtgtc
tttattgaatttatctatgttttagttgatcctagaattaggattgcaaatagttctaat
gttagcttattaactaagttaaagttcttaagttcaagacaccaatggttaatgaagtga
aacaagattaacagtgataatgcccaaaatattgtgtttaactcgccactgcaccaccag
ctattagaactcaatgcaattgattacaaaacaaaaacagttcaactaacaactgaacaa
aaaactgctctcaatatcagtgcaactgctaactttatcttacttggtaacaagtgttta
aaactcaaaacaatccatggatag

DBGET integrated database retrieval system