KEGG   Mycoplasma genitalium G37: MG_082Help
Entry
MG_082            CDS       T00002                                 

Gene name
rplA
Definition
(GenBank) ribosomal protein L1
  KO
K02863  
large subunit ribosomal protein L1
Organism
mge  Mycoplasma genitalium G37
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MG_082 (rplA)
Ribosome [BR:mge03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MG_082 (rplA)
  Bacteria
    MG_082 (rplA)
  Archaea
    MG_082 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
109675..110355
Genome map
AA seq 226 aa AA seqDB search
MKKLSKRMQAVTKLIDKNKLYPIQEAFELIKKTAITKFVSSVDIAVSLNLDTTKAEQQLR
GAIAFPFSIGKSIRILAITDDEKKASEAGADFVGGLDKIEAIKNGWLDFDLIITSPKFMG
ALGKLGKLLGTRGLMPNPKTETVTDDVVSAIKAYKKGKKEYRTDSFGNIHLSLGKTDTKT
EHLVANAMALIDLIKSKRPSTVKGTYIKNIALTTTMGPSLKVKLPD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactatcaaaaaggatgcaagctgttaccaagctcattgataaaaacaaactt
tatcctatccaagaagcatttgaattaattaaaaaaacagcaattactaagtttgtcagt
tcagttgatattgctgttagtttaaaccttgatactactaaagctgaacaacagttaaga
ggtgcaattgcttttccttttagtattggtaaatctatcagaattttagctatcactgat
gatgagaaaaaagctagtgaagcaggtgctgattttgttggtgggcttgataagatagaa
gcgataaaaaatggctgattagattttgatctaattatcacttctcccaagttcatggga
gcattaggtaaactaggaaaactattaggaaccaggggattgatgccaaacccaaaaact
gaaacagttactgatgatgtagttagtgctattaaagcttataaaaagggtaagaaagaa
tatcgaactgattcatttggcaacatccacctctctttaggtaaaacagataccaaaact
gagcacttggttgctaatgccatggctttaatagatttaattaagtctaaacgtcctagc
acagtcaaaggtacttacattaaaaatattgctttgacaacaacaatgggaccaagttta
aaagtaaagctacctgattaa

DBGET integrated database retrieval system