KEGG   Mycoplasma genitalium G37: MG_085Help
Entry
MG_085            CDS       T00002                                 

Gene name
hprK
Definition
(GenBank) HPr(Ser) kinase/phosphatase
  KO
K06023  
HPr kinase/phosphorylase [EC:2.7.11.- 2.7.4.-]
Organism
mge  Mycoplasma genitalium G37
Brite
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.-  
     MG_085 (hprK)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     MG_085 (hprK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
111790..112725
Genome map
AA seq 311 aa AA seqDB search
MKHLTVKALVLQFNDCIQLIDGKNNIDNVITIPGLKRSVFELLGLFCKPIGSVAILGKRE
FIFLNQKPVEQQKKIIANLLKLKPPAVILTKSFLDCGVLLAVNQTYQVPILKTNLFSTEL
SFTVETYINEQFATVQKLHGVLLEIFGVGVFLEGKSGIGKSESALDLINKNHLLIGDDAI
EIYRLGNRLFGRAQALAKGFMEIRGLGIINIERAYGLQITKEQTEIQLAISLLSLEEKNN
ASFERLGSDLKLKNLLGVKISYYQIPISSGRKTSEIIESAVIDFKLKKSGYNSANEFILK
QRAMLEEQTDE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttaactgtcaaagcattagttttgcaatttaatgattgtatccaactcatt
gatggtaaaaacaacatagataatgtgattactatccctgggttaaaaaggagtgttttt
gaactattaggactattttgtaagccaattggttcagttgctattttaggtaaacgtgaa
tttatttttttaaatcaaaagccagttgagcaacagaaaaagattattgcaaacctcttg
aaactcaaaccacctgcagttattctaaccaagtcatttcttgattgtggtgttttgtta
gctgttaatcaaacttatcaagttcctattttaaaaactaacttgttttcaactgaactc
tcttttactgttgaaacctatattaacgagcaatttgctactgttcaaaagttacatggg
gttttacttgaaatctttggtgttggggtatttttagaaggaaagagtgggattggtaaa
tctgaaagtgctttagatttaattaataaaaaccaccttctaataggtgatgatgctatt
gagatctacagattaggcaataggttatttggtagagcacaagcactggcaaaaggcttt
atggagattagaggtcttggcatcattaatattgaacgtgcttatgggttacagattaca
aaagaacaaactgaaatccaactagcaattagtttgttgagtttagaggagaaaaacaac
gctagttttgagcgcttaggcagtgatttaaaactaaaaaatctgcttggggttaagatt
agttactatcagatccctatctcttcaggtagaaaaacaagcgaaattattgaaagtgca
gtaatcgattttaaacttaagaaaagtggttacaattcagcaaacgagtttatcttaaag
caacgtgccatgttagaagaacaaactgatgaatag

DBGET integrated database retrieval system