KEGG   Mycoplasma genitalium G37: MG_086Help
Entry
MG_086            CDS       T00002                                 

Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  
phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC:2.-.-.-]
Organism
mge  Mycoplasma genitalium G37
Brite
Enzymes [BR:mge01000]
 2. Transferases
  2.-  
   2.-.-  
    2.-.-.-  
     MG_086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
112718..113866
Genome map
AA seq 382 aa AA seqDB search
MNRPSWSTAFNIGGGFPIQWYGIIVSIGIIFAILMFVFKLIYCYKLQDNSFYFFIFIAVL
TMVLGARLWSFVIGDSNFANNNFFDFRNGGLAIQGGILLTSIVGVIYFNFFLNSKTNKTK
TIAELLNNKNEIKAVYVERNISVLVMLDLIAPCVLIGQAIGRWGNFFNQEVYGFALAGTM
NDPQALANTQWGFLKILMPKVWDGMWIDGQFRIPLFLIESFFNTIFFVLIYFVMDFIRGV
KSGTIGFSYFLATGIIRLILENFRDQTFYFQTSITTSILFIVVGILGIFYCQFIHVKLRN
YFWTYFFLYAFYKVAAFFTTLFLNNRKQMAQQKFAFYEKSLPNKKRSFFEMKYYNDVTTP
KIYRLTDQEMKLFDKLEAVTTS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaccaagttgatcaactgcatttaatattggtggtggatttcccatccagtgg
tatgggatcattgtctcaattggcattatttttgccattttaatgtttgtctttaaactg
atttattgttacaaattacaagacaacagtttttatttttttatctttattgctgtttta
acgatggttttaggcgctcgcctctggtcatttgtaattggtgattccaattttgctaac
aacaatttctttgattttcgtaacggtggattggccattcagggtgggattttgttaacc
agtattgtcggagtaatctatttcaacttctttttaaatagtaagaccaataaaaccaaa
acgattgctgaattactgaataataagaatgaaataaaagctgtttatgttgaaagaaat
atctctgttctagtgatgttagatctgattgctccttgtgttttaattggtcaagcaatt
ggcagatggggtaattttttcaaccaagaagtttatgggtttgctttagctggaacaatg
aatgatccccaagcattggctaatacccagtggggatttttaaagatcttaatgcctaag
gtttgggatgggatgtggattgatggtcagtttcgcattccgctctttttaattgagtca
ttttttaacactattttctttgtgttaatttactttgtaatggattttattaggggagtt
aaaagtggcacaattggttttagttattttcttgctactggaatcattcgtttaatcttg
gaaaactttagagaccaaaccttttattttcaaacttcaataaccactagtattttgttt
attgtcgttggtattttaggaattttttattgccagtttatccatgtcaaattaagaaat
tacttctgaacttatttctttctttatgccttttataaagtagctgcttttttcactaca
ctttttttgaataacagaaagcaaatggcacaacagaagtttgctttttatgaaaaatca
cttcccaataagaagcgttctttttttgaaatgaagtattacaatgatgtaacaacaccc
aaaatttatcgtttaactgatcaggaaatgaagttatttgataaattagaggcagttaca
accagctag

DBGET integrated database retrieval system