KEGG   Mycoplasma genitalium G37: MG_088Help
Entry
MG_088            CDS       T00002                                 

Gene name
rpsG
Definition
(GenBank) ribosomal protein S7
  KO
K02992  
small subunit ribosomal protein S7
Organism
mge  Mycoplasma genitalium G37
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MG_088 (rpsG)
Ribosome [BR:mge03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    MG_088 (rpsG)
  Bacteria
    MG_088 (rpsG)
  Archaea
    MG_088 (rpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
114331..114798
Genome map
AA seq 155 aa AA seqDB search
MRKNRALKRTVLPDPVFNNTLVTRIINVIMKDGKKGLAQRILYGAFEIIEKRTNQQPLTV
FEKAVDNVMPRLELKVRRIAGSNYQVPTEVPPDRRIALALRWIVIFANKRNEKTMLERVA
NEIIDAFNNTGASVKKKDDTHKMAEANKAFAHMRW
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatcgtgctttaaaaagaactgttttacccgatcctgtttttaacaacaca
ctggttacaaggattattaatgtcatcatgaaagatggcaagaagggtttagcacaacgc
atcttgtatggtgcttttgagatcattgaaaaacgcaccaaccaacaacctttaactgtc
tttgaaaaagcagttgataatgttatgccccgcttagagttaaaagtgagaagaattgct
ggttctaactaccaagtaccaactgaagttccccctgacagaaggattgctttagcacta
agatggattgtgatctttgctaacaaaagaaatgaaaaaacaatgcttgaacgtgttgct
aatgaaattattgatgcttttaataacacgggtgctagtgttaaaaagaaggatgatact
cacaagatggcagaagctaacaaagcctttgcccacatgcgttggtag

DBGET integrated database retrieval system