KEGG   Mycoplasma genitalium G37: MG_097Help
Entry
MG_097            CDS       T00002                                 

Definition
(GenBank) uracil-DNA glycosylase, putative
  KO
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mge  Mycoplasma genitalium G37
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mge00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MG_097
Enzymes [BR:mge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     MG_097
DNA repair and recombination proteins [BR:mge03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MG_097
 Prokaryotic Type
     MG_097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
123580..124317
Genome map
AA seq 245 aa AA seqDB search
MVMDDLFQRMVSCVLPSWRAFIDEEVKKPYFQALLEKLKALKATIIPKPELIFRVFSFFK
PIDTKVIIFGQDPYPSPNDACGLAFASNNSKTPASLKRIILRLEKEYPSLKQESSWQQNF
LLNWAEQGVLLLNGILTTTVFIRNAHKNWGWEEFNCNLLTFLKNQNIKPLLVFLGVQTKN
FVVKSIGNVDGFEHLSYPHPSPLSGNLFLTNPNDLFKTINNWLKQHNQKIINWAVVKNAS
FDQLS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtggtaatggatgatctattccaaagaatggttagctgtgttctaccgtcatgaagagct
tttattgatgaggaagttaaaaaaccttattttcaagctttattagaaaaattaaaggct
ttaaaagcaacaataattccaaaaccagaacttattttccgtgtttttagcttctttaag
ccaattgatacaaaggtaattatctttggtcaagatccctatcctagtcctaatgatgct
tgtggacttgcttttgcatccaataattccaaaacccctgccagcttaaaaagaataatt
ttacgtttagaaaaagaatatccttcgcttaaacaagaaagtagttgacaacaaaacttc
ctattgaattgagcagaacagggcgttttattactaaatggaattttaacaactactgta
tttatacgcaacgcccataaaaattggggttgggaggagtttaactgtaatttgctaact
tttctaaaaaatcaaaacattaaaccgctgttggtatttctgggtgttcaaactaaaaac
tttgttgttaagagtattggtaatgttgatggatttgagcatttatcatatccccatccc
tcaccactaagtggtaatttgtttctaacaaaccctaacgatctgtttaaaacaattaac
aattggttgaaacaacataaccaaaaaataattaactgagcagttgttaaaaatgctagt
tttgaccaattaagttaa

DBGET integrated database retrieval system