KEGG   Mycoplasma genitalium G37: MG_101Help
Entry
MG_101            CDS       T00002                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
128687..129355
Genome map
AA seq 222 aa AA seqDB search
MKFGKEIAKKNQIIYRYIILKIQSFEWPANTRIFSERQLEIRFNSSRSQIRSVLATLLNK
NIIRYTKNTPGYFVCKDVGFSFFHKTQDNLKVKYAKLSTLIKKLLSQDDASVFANIDSTV
HLDKFKGIEAKFFDENKKHFLNVCFFAKDDILNILDENNLQQQFFREFAYNGIAIEKRHC
VTSVDKESGCLVMYDMYYDDNDNFVVASKSNFLNPELKVINA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgggaaagagatagctaaaaaaaatcaaattatttatcgctatataatcctt
aaaattcaaagctttgaatgacctgctaacacccgtatcttctcagaacgccaactagaa
atccgtttcaactcctcacggagtcaaattcgctctgttctcgctacgcttttaaacaaa
aatataatccgctacactaaaaatacccctggttattttgtgtgtaaagatgtaggcttt
agtttttttcataaaacccaggataatctgaaggtgaaatatgctaaactttcaactttg
attaaaaagctgttatcacaggatgatgctagtgtttttgccaatattgacagtactgtg
caccttgataaatttaagggaattgaagctaagttttttgatgagaataaaaaacacttt
ttaaacgtttgtttttttgctaaagatgatattttaaacatccttgatgaaaacaacctc
cagcaacagttcttcagggagtttgcttacaatgggattgctattgaaaaacgtcattgt
gttacctctgttgacaaggaaagtgggtgcttggtgatgtatgacatgtattatgatgac
aatgataattttgtagttgctagcaaaagtaacttccttaaccctgaattgaaagtaatc
aatgcttaa

DBGET integrated database retrieval system