KEGG   Mycoplasma genitalium G37: MG_106Help
Entry
MG_106            CDS       T00002                                 

Gene name
def
Definition
(GenBank) peptide deformylase
  KO
K01462  
peptide deformylase [EC:3.5.1.88]
Organism
mge  Mycoplasma genitalium G37
Brite
Enzymes [BR:mge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     MG_106 (def)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(134147..134728)
Genome map
AA seq 193 aa AA seqDB search
MTFQPTKTWLVFDDNALINKPTEAVNFPIDEQIETCIKKMIAYVDASYDGKAQEYDIIPG
IGIAANQIGYWKQLFYIHLNDLNKEKKCLLINPKIIDQSENKAFLESGEGCLSVKKQHKG
YVIRSEWITIKGYDWFEKKEITIKATGLFGMCLQHEFDHLQGRFFYQRINPLNPWFKKPE
WKVINPTLKTSNG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaaccaactaaaacttggcttgtttttgatgataatgctttgattaacaag
ccaactgaagctgttaattttccaatagatgagcaaattgaaacctgtattaaaaagatg
attgcatatgttgatgcttcatatgatggtaaagcacaagaatatgacattattccagga
attgggatagctgctaaccagattggctattgaaaacaactgttttacatccacctcaat
gatttaaacaaagaaaaaaagtgcctactgatcaatcctaaaattattgatcaaagtgaa
aataaagcatttttagaaagtggtgaggggtgtttaagtgttaaaaagcagcacaaaggt
tatgtaattcgtagtgaatggatcactattaaaggttatgattggtttgaaaaaaaagag
attaccattaaagcaactggactatttggaatgtgtttacagcatgaatttgatcactta
cagggacgctttttttaccaaagaattaaccctttgaatccatggtttaaaaaaccagaa
tgaaaagtgattaatcctactttgaagacaagtaatggataa

DBGET integrated database retrieval system