KEGG   Mycoplasma genitalium G37: MG_107Help
Entry
MG_107            CDS       T00002                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mge  Mycoplasma genitalium G37
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mge00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
134769..135338
Genome map
AA seq 189 aa AA seqDB search
MNNQGRIFVITGPSGVGKSTLVKALLDHFKEQLFYSISATTRKKRISEKEGIDYFFKDKD
EFENLIKQDAFIEWACYNNHYYGTLKSQAEQAIKSGINLMLEIEYQGALQVKSKYPHNVV
LIFIKPPSMQELLKRLKKRNDEDETTIKKRLEQAKIEFQQIDNFKYVVTNKEFDKTLNEL
KSILLSEFI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatcaggggagaatttttgtcattactggtcctagcggtgttggcaaaagcacc
cttgttaaagccttattagatcatttcaaagaacaactgttctacagtatctctgcaact
acaagaaaaaagcgcattagtgaaaaagagggaattgattatttttttaaagataaagat
gagtttgaaaacttaataaaacaagatgctttcattgaatgggcttgctataataaccat
tattatggaacgctcaagtctcaagctgaacaagcaattaaaagcggaattaatttaatg
cttgaaattgagtatcaaggtgctttacaggttaaaagtaaatatcctcataacgttgtt
ttaattttcattaaaccaccttcaatgcaagagttgttaaaacgtttaaaaaagcgtaat
gatgaagatgaaaccacaattaaaaaacgtttagaacaagctaagatagagtttcaacag
attgataattttaagtatgttgtcactaacaaagagtttgataaaacccttaatgagttg
aaatcaatcttactatctgagtttatttaa

DBGET integrated database retrieval system