KEGG   Mycoplasma genitalium G37: MG_108Help
Entry
MG_108            CDS       T00002                                 

Definition
(GenBank) protein phosphatase 2C, putative
  KO
K20074  
PPM family protein phosphatase [EC:3.1.3.16]
Organism
mge  Mycoplasma genitalium G37
Brite
Enzymes [BR:mge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MG_108
Protein phosphatases and associated proteins [BR:mge01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    MG_108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
135338..136120
Genome map
AA seq 260 aa AA seqDB search
MQAANDHFFTGLSKKGPVRKENQDFYGFSFNQNNLLIVVCDGLGGYKGGKIASNLVGKLF
LSLFEGFEFNQWDETTVKKWFENTLIQARFQLENCFQTVYEAQIQFARMASTLVLGILTK
SDIYIFWIGDSRAYLLFENQAKLVTKDHNLYNQLVAMNADEKLLLSYSNQLLALTNTISK
ETKRPLVYGFYNTKIEQQEFLLLCSDGLYNFVEKELFFEIITNSKNLKQAVFNLYRKSIE
NASNDNITAALVNLQKWKQS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgctaatgatcatttctttaccggtttatcaaaaaaaggtcctgtaagaaag
gaaaatcaggacttttatggatttagttttaatcaaaataacctactaatagttgtttgt
gatggtcttggtggttataagggtggcaagattgctagtaacttagtaggtaaactcttt
cttagtttatttgaaggttttgaatttaaccagtgagatgaaactacagttaaaaagtgg
tttgaaaatactttaatacaagcacgctttcaactagaaaattgttttcaaacagtttat
gaagcacaaatccagtttgctaggatggctagcaccttggtcttgggaattttaactaaa
agtgatatttatatcttttgaattggtgattccagagcttacttattatttgaaaaccaa
gctaagttagttactaaggatcacaatctttataaccagttagttgctatgaatgctgat
gagaaattacttttaagttattctaatcaacttttagcattaacaaatactatttccaaa
gaaacaaaaagaccattagtttatggtttttataacacaaaaattgaacaacaagaattt
ttattattgtgttctgatggactttataactttgttgaaaaagagcttttttttgaaatt
atcactaattctaaaaacctaaaacaagcagtgtttaatctttatagaaaaagtattgaa
aatgcaagtaatgataatattactgctgcccttgttaatctgcaaaaatggaagcaatct
taa

DBGET integrated database retrieval system