KEGG   Mycoplasma genitalium G37: MG_109Help
Entry
MG_109            CDS       T00002                                 

Definition
(GenBank) serine/threonine protein kinase, putative
  KO
K12132  
eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mge  Mycoplasma genitalium G37
Brite
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MG_109
Protein kinases [BR:mge01001]
 Serine/threonine protein kinases: Other group
  Bacterial family
   MG_109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
136105..137268
Genome map
AA seq 387 aa AA seqDB search
MEAILKIGDIVENKYQIEKLLNRGGMDSYLFLAKNLNLKNYGPVQKKQYGHLVLKVVQKN
PKINENNWKKFLDEMVTTTRVHHSNLVKSFDVVNPFLKIVRGNKTIALNQIVMIAMEYVD
GPSLRQLLNRKGYFSVSEVVYYFTKIVKAIDYLHSFKHQIIHRDLKPENILFTSDLTDIK
LLDFGIASTVVKVAEKTEVLTDENSLFGTVSYMIPDVLESTVNKAGKKVRKPPNAQYDIY
SLGIILFEMLVGRVPFNKSINPNKERETIQKARNFDLPLMQATRSDIPNSLENIAFRCTA
VKRENNKWLYSSTKELLEDLANWENEQAMIKPANERVLEGQVEIREMMLEKPLAWYFKTW
ALSIFTIVFIGLIIAAIVLLLIFNARF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaatcttaaagataggtgatattgttgaaaataagtatcaaattgaaaagctt
ttaaataggggtgggatggattcctatctttttttagcaaaaaatttgaacttaaaaaac
tatggaccagttcaaaaaaaacagtatggacacttagttttaaaggtggttcaaaaaaat
cctaagattaatgaaaataattggaaaaagttccttgatgaaatggtaaccacaactaga
gtgcaccattctaacctagtgaaaagttttgatgtggtgaacccttttttgaaaatagtt
cgtggtaataaaacaattgctctcaatcagatagtgatgattgcaatggagtatgttgat
ggcccttctttaagacaattgcttaacagaaaaggctactttagtgttagcgaagtagtt
tattactttacaaagatagtaaaagccattgattatctccacagtttcaagcaccaaatt
atccaccgtgatcttaaacctgaaaacatcttatttactagtgatttaactgatattaaa
ctattagattttggcattgcttcaacagtagttaaagttgctgaaaaaaccgaagtttta
actgatgaaaattcactgtttggcacagttagttatatgattcctgatgttttggaaagc
acagttaataaagctggtaaaaaggttagaaaaccacccaatgcccagtatgatatctac
tcgttaggaattattctatttgagatgttagttggtagagttccatttaacaagtcaatt
aaccccaacaaggaaagagaaacaatccaaaaagcacgcaattttgacttacctttaatg
caagcaactagaagtgatatcccaaatagcttagaaaatattgcttttcgttgtactgct
gtgaaaagagaaaacaataagtgactttacagttccacaaaagaacttttagaagatttg
gcgaattgagaaaatgaacaagcgatgattaaacctgctaatgaaagggttttagaaggg
caggtggaaattagagaaatgatgcttgaaaagcccttagcttggtatttcaaaacttga
gccttatcaatctttactatcgtttttatagggttaattattgctgcaatagttctttta
ttaatttttaatgccagattctaa

DBGET integrated database retrieval system