KEGG   Mycoplasma genitalium G37: MG_110Help
Entry
MG_110            CDS       T00002                                 

Gene name
rsgA
Definition
(GenBank) ribosome small subunit-dependent GTPase A
  KO
K06949  
ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
mge  Mycoplasma genitalium G37
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MG_110 (rsgA)
Enzymes [BR:mge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     MG_110 (rsgA)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     MG_110 (rsgA)
Ribosome biogenesis [BR:mge03009]
 Prokaryotic Type
  GTPases
   MG_110 (rsgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
137255..138091
Genome map
AA seq 278 aa AA seqDB search
MPDSNFGIVLQSLAKQCKVFWNNQIITAFPQKKLQWKNDFKLMVGDRVQLEDGAITKVLA
RKNELTRPRVANVDQIVLIQSLVQPKINWIQLLKLLVYFNAKLIDEIPILITKTDLDFDP
MEKQKLIDLKQFNYQLFFVSKNEPLPSELIDIFSKKLSVFTGQSGVGKSSLINRLDPSLK
QKIQALSVNKFGKNTTTKTTLFSFRGGFICDTPGFNVISIKNLKILAAQHFVGFQKMISK
CHFSNCYHQYEKDCFVTTSVMKNRYPSWLYEKYRKMIN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccagattctaactttgggatagtgcttcagtcattagcaaaacaatgcaaagtattt
tggaataaccagataataactgcttttcctcaaaagaagttacagtgaaaaaatgatttt
aagttgatggttggtgatagggttcaacttgaagatggtgcgatcactaaagttttagct
agaaaaaatgaacttacaagaccaagggttgctaatgttgatcagattgttttaatccaa
tcactagttcaacctaagattaactgaattcaactgttgaaattattggtatatttcaat
gctaaattaattgatgaaatacctattttaataacaaaaacagaccttgattttgatcca
atggaaaaacaaaagttaatcgatttaaaacagtttaactatcagttattttttgtttct
aaaaatgaaccactaccttcagaattaatcgatatttttagtaaaaaactaagtgttttt
acaggtcaatctggtgttggtaaatctagcttaattaatcgtttagatccttctttaaaa
caaaagattcaagccttatcagttaataaatttggtaagaataccactactaaaacaaca
cttttttcatttagaggcggttttatttgtgacacccctggttttaatgtaatttctatt
aaaaacctcaaaattttagcagcccaacactttgttggttttcagaaaatgattagtaag
tgtcatttttctaactgttatcatcagtatgaaaaagattgctttgtaaccacaagtgtt
atgaaaaacagatatccttcgtgattgtatgagaagtatagaaaaatgattaattaa

DBGET integrated database retrieval system