KEGG   Mycoplasma genitalium G37: MG_111Help
Entry
MG_111            CDS       T00002                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
mge  Mycoplasma genitalium G37
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MG_111 (pgi)
   00030 Pentose phosphate pathway
    MG_111 (pgi)
   00500 Starch and sucrose metabolism
    MG_111 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    MG_111 (pgi)
Enzymes [BR:mge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     MG_111 (pgi)
Exosome [BR:mge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MG_111 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   MG_111 (pgi)
  Exosomal proteins of colorectal cancer cells
   MG_111 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
138106..139407
Genome map
AA seq 433 aa AA seqDB search
MFMSDKLLTIDLSHVYGFDKEIIFKKYQKKVDQIHQDFLAHKLADGHMTGWYDQPDQNHQ
FLLKTINQIDKKFKSLKVTDIVYVGIGGSFTGIKTVLDFLKPKQRTGLKIHFVPDLSAFQ
AASVIKEIKNKSWALITTSKSGRTLEPALNFRIFRNLLNKRYGNKHYQRVVVITDEKKGL
LTKMASNHGYQKLVIDSNIGGRFSTLSPAGLLLAKLFGHDPKAILKGTLQAKKDLQTTSL
ENNSAYLYAVVRHWLYTTKKFKIEVCIAYHSLYEYLLLQHRQLFGESEGKNDKSLFPTFS
IFTVDLHSMGQLYQEGEKVFFETVIDVKNPLVNINLPPSDFDNDDELDFLLDKSLNEISD
VAIDSVIKAHYQANVSIIKLTLKEQSAFMFGYFYFWLSVATVMSGSLLGHNVFNQPGVEV
YKKLMFEKLRSGH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatgagtgataaattattaacaattgacttaagtcatgtttatggatttgataaa
gaaattatttttaagaaataccaaaaaaaagtagatcaaattcaccaagattttctagct
cataaacttgctgatggtcacatgactgggtggtatgaccaacctgatcaaaaccaccaa
ttccttttaaaaaccattaatcaaattgacaaaaagtttaaaagtttaaaagtaactgac
attgtttatgttggtattggtggttcttttactggtattaaaacagttttagatttctta
aaaccaaaacaaagaacaggattaaaaatccactttgtccctgacctttctgcttttcaa
gctgcaagtgttattaaggaaattaaaaataaatcatgggctctaattaccacttctaag
tctggtagaaccctagaaccagcactgaatttccgcatttttagaaacttattaaacaag
cgttatggcaacaaacactaccaaagagtagttgttattactgatgaaaaaaagggatta
ctaaccaaaatggcatcaaatcatggttaccaaaagttagttattgattcaaatatcggt
gggcgtttttcaactctatctcctgctggtttgttactagccaaactttttggtcatgat
cctaaggccatcttaaaaggaacattacaagccaaaaaggatttgcaaacaacttcactt
gaaaacaattctgcatacctttatgcagtagttagacattgactatacaccacaaaaaaa
ttcaaaattgaagtttgcattgcttatcacagtttgtatgaatatttgttattacagcat
cgacaactttttggtgaatcagaaggtaagaacgataaatctttatttcctactttttcg
atttttactgttgacttacactcaatgggacaactctatcaagaaggggaaaaagtgttt
tttgaaacagtaattgatgttaaaaatccacttgttaatattaatttacctccatctgat
tttgacaatgatgatgaacttgatttcttgttagataaaagcttaaatgagatttcagat
gttgcaattgattcagttattaaagcgcactaccaagcaaatgtaagcattattaaatta
actttaaaagaacaatctgcatttatgtttggttatttttacttttgactctctgttgct
acagtgatgagtggatcattattagggcataatgtctttaatcaacctggcgttgaagtt
tataaaaagttaatgtttgaaaaactaagaagtggccactaa

DBGET integrated database retrieval system