KEGG   Mycoplasma genitalium G37: MG_112Help
Entry
MG_112            CDS       T00002                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mge  Mycoplasma genitalium G37
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MG_112 (rpe)
   00040 Pentose and glucuronate interconversions
    MG_112 (rpe)
Enzymes [BR:mge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     MG_112 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
139397..140026
Genome map
AA seq 209 aa AA seqDB search
MATKVVFSLLPLLNRFDKSLLESYFQDGLRLIHYDVMDQFVHNTAFKGEYLDELKTIGFD
VNVHLMVEQIIPQINFYLSQPNVKRISFHVEPFSFAKIKELIQLVKENGKEVGLAFKFTT
NLQLYQPFFTTIDFITLMSVPPGKGGQAFNEAVFTNLKIANHYNLKIEIDGGIKVNNIDQ
IKAFVDFIVMGSGFIKLEQWQRQKLLQTI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggccactaaggttgttttttcactcttaccacttttaaataggtttgacaagtcactt
ttagaaagttactttcaagatggattgaggttaatccattatgatgtgatggaccaattt
gttcataatactgcttttaaaggtgaatatttggatgaattgaaaacaataggttttgat
gttaatgtccatttaatggtggaacagatcatccctcaaataaatttttatctttcacaa
cctaatgtgaaaaggatttcgtttcatgttgaaccatttagttttgcaaagattaaagaa
ctaatccaactagttaaagaaaatggtaaagaagttggtcttgcttttaaatttacaacc
aatttacaactataccaaccattttttacaaccatcgactttatcactttaatgagtgtt
cctcctggtaaaggtggtcaagcttttaacgaagctgtttttacaaatttaaagattgct
aaccattacaacttgaaaattgagattgatggtgggattaaagttaataacattgatcaa
attaaagcctttgttgatttcattgtaatgggaagtggctttataaaattagagcagtgg
caacgtcaaaaattgttgcaaacaatctaa

DBGET integrated database retrieval system