KEGG   Mycoplasma genitalium G37: MG_115Help
Entry
MG_115            CDS       T00002                                 

Definition
(GenBank) competence/damage-inducible protein CinA domain protein
  KO
K03743  
nicotinamide-nucleotide amidase [EC:3.5.1.42]
Organism
mge  Mycoplasma genitalium G37
Pathway
Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MG_115
Enzymes [BR:mge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.42  nicotinamide-nucleotide amidase
     MG_115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
142081..142554
Genome map
AA seq 157 aa AA seqDB search
MFANLIAEKLQKLQLSVATAESVTGGLLAHCLTSIDGASNYFNGGVIAYNNQVKINLLNV
QSSTIANHGAVSSFCAREMAVGVKQKFQADVGIACSGIAGSKAVENKAIGLLFFCIIIGN
KAYDFEFEMNQNNRKDNIELFTNKILESFHYLLTKLA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgccaatttaatagcagaaaaactccaaaagttacaacttagtgttgcaacagct
gaatcagttactggtggcttattagctcattgtttaacttccattgatggtgcttctaac
tattttaatggcggtgttattgcttacaataaccaagttaagattaacttactgaatgtt
caatcctccacaattgcaaaccatggggcagtttccagtttctgtgctagggagatggca
gttggggttaaacaaaagtttcaagctgatgtgggtattgcttgcagtgggatagcaggt
agtaaagcagttgaaaataaagcaataggattactttttttctgtattattataggaaat
aaggcttatgattttgagtttgaaatgaaccaaaataatcgtaaggataacattgaatta
tttaccaataagatcttggaatctttccactatttgttaacaaagctagcttaa

DBGET integrated database retrieval system