KEGG   Mycoplasma genitalium G37: MG_116Help
Entry
MG_116            CDS       T00002                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
142563..143318
Genome map
AA seq 251 aa AA seqDB search
MKRTLNIGIVLCENFLSDQQNAVDSYTQVYEDVRMFEFGLKLFQSLPFNIQETLIFCNAE
QHKIVDKAAKKYKNTTVFFSRDTDVANVYEAKVFIQEKYKLTQDYKKRGVSSYYDSCCFI
LIEANRPLTAIKTVKSVYEKALIEKAAIAVLPYNGTLMNGNNDVVFSHLQDKNRFNYWKQ
SKAYEVQYPQAYTLNKLNQFSKQQFLRARSMLDLMKISNKSPLSIVDGSAYAFRVVTNLD
FEILLGILKNG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtactttaaatataggtattgttttgtgtgaaaattttctttcagaccaacaa
aatgctgttgatagttacacccaagtttatgaagatgttaggatgtttgaatttgggtta
aaactctttcaatcattaccttttaacatccaagaaacccttatattttgtaatgctgaa
caacataaaatagttgataaagctgctaaaaaatacaaaaacactactgtgtttttttca
cgtgatactgatgtagctaatgtttatgaagctaaggtatttatccaagaaaaatacaaa
ttaacccaagattacaaaaaaagaggtgttagctcttattatgacagctgttgctttatc
ttaattgaagcgaatcgtccattaactgcaataaagacagttaaaagtgtttatgaaaaa
gcactgatagaaaaagcagctattgcagtattaccatataatggtacactaatgaatggt
aacaatgatgttgtctttagccacttgcaagataaaaataggtttaactattgaaaacaa
agcaaggcttatgaagtacaatacccccaagcatatactttaaataaacttaatcagttt
tcaaaacagcaatttctaagggctagaagtatgttggacttaatgaagatttctaataaa
tcacccttaagtattgttgatggtagtgcttatgcttttagggttgttaccaaccttgat
tttgaaattttattaggtattttaaaaaatggataa

DBGET integrated database retrieval system