KEGG   Mycoplasma genitalium G37: MG_117Help
Entry
MG_117            CDS       T00002                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
143311..143955
Genome map
AA seq 214 aa AA seqDB search
MDKNIFQLVQSFAKTQNVRANYTSQDKNISLDFVSFETVSQSLTGFLIFNNFNKLLQLIE
LIKQKQTWLYVDQLWIVDLSNNKALTDATVWIIKQEKLPVSVAAFSNQQLNQVYRNSSTS
PLYLSYVKPIEVQQFFTLSPSINNNPFLNQNPLTESPFDNNNQLFQATKSVEPSMETMEF
SRFMDEFDQITKNFSDIELEPMQFTQSFDDWSKD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatatttttcaattagtacaaagttttgctaaaacgcaaaatgtgcgagct
aattacacctcacaagacaaaaatattagtttagattttgttagttttgaaacagttagt
caatcactaacaggttttctaatttttaataatttcaataaattgttacaactaattgaa
ctgataaaacaaaagcaaacatgattatatgtagatcagctctgaattgttgatctttcc
aataacaaagccttaactgatgctactgtttggattattaaacaagaaaaattgcctgtt
tcagttgcggcttttagcaaccaacaactcaaccaagtttatcgcaattcatccacaagt
cctttgtatcttagttatgtcaaaccaatcgaagttcaacaattttttacactttctcca
tccattaacaataatccttttttaaatcaaaatcctttaactgaatcaccatttgataac
aataatcagctgtttcaagcaacaaagagcgttgaaccttcaatggaaacaatggaattt
tcccggtttatggatgaatttgatcagattacaaagaacttttctgatatagagcttgaa
cctatgcaattcacccaaagttttgatgattggagcaaagactag

DBGET integrated database retrieval system