KEGG   Mycoplasma genitalium G37: MG_118Help
Entry
MG_118            CDS       T00002                                 

Gene name
galE
Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  
UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
mge  Mycoplasma genitalium G37
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MG_118 (galE)
   00520 Amino sugar and nucleotide sugar metabolism
    MG_118 (galE)
Enzymes [BR:mge01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     MG_118 (galE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
143936..144958
Genome map
AA seq 340 aa AA seqDB search
MIGAKTRVAIVGGIGYIGSCFASFIKEQNDKLIVTVIDNNKNNHVIKLLKKIGIEFYFAD
LLDRHKLTEVIAAIQPDVVFHFAAKTSVSESVHNPLKYFDCNVIGTLNLISAISNLQKPI
KLFFASSAAVYGQTTNSYISEEIVITETQATNPYGLSKFLDELILNAVAKNSQLQVVCLR
FFNVAGAILPFGNFNGNTTLLIPNLVKAFLKQTPFFLYGNDYATKDGSCIRDYIHVYDIC
NAHFLLWKWLNDHRQIKFETFNLGSGIGTSNLEVIDIAKKVFYPSRLNLEIRPKRSWDPA
ILVANVAKAKQTFQFKITRNLKDMISDERNFYENFYNDAY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgattggagcaaagactagggttgcaatagttggcgggattggttacataggtagttgt
tttgctagttttatcaaagaacaaaatgataagctaattgttactgttattgataacaac
aaaaataaccatgtaattaaactcttaaaaaagattggaattgaattctattttgctgat
ttactagatagacataagctaactgaagtaattgcagcaattcaacctgatgtggtattt
cactttgctgctaaaacaagtgtaagtgaatcagtacataatccattgaagtactttgat
tgcaatgtaattggtactttaaacctaattagtgcaattagtaacttacagaagccaatt
aaattatttttcgcttctagtgctgcagtgtatggtcaaacaactaatagttacattagt
gaagagattgtaataactgaaacacaagcaaccaatccttatggattgagtaagttttta
gatgaattaatcttaaatgcagttgccaaaaatagtcaactacaagttgtttgcttacgc
ttttttaatgtggcaggtgcaattctgccatttggtaattttaatggtaataccacgctt
ttaattcctaacttagtaaaagcctttttaaaacaaactcccttttttttatatggcaat
gattatgcaactaaggatggtagttgcataagagattacatccatgtttatgatatatgt
aatgctcatttcttattatgaaagtggttaaatgatcatcgccaaattaaatttgaaacc
tttaacttggggagtgggataggaacttctaatttagaagttattgatattgctaaaaaa
gtgttttatcctagtagattaaatttagaaattagaccaaaaagaagctgagatccagca
attttagtagcaaatgttgctaaagcaaaacaaacctttcaattcaaaataacgcgtaat
ttgaaagatatgataagtgatgagcgtaatttttatgagaatttttataatgacgcttat
taa

DBGET integrated database retrieval system