KEGG   Mycoplasma genitalium G37: MG_121Help
Entry
MG_121            CDS       T00002                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K02057  
simple sugar transport system permease protein
Organism
mge  Mycoplasma genitalium G37
Brite
Transporters [BR:mge02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    MG_121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
148239..149159
Genome map
AA seq 306 aa AA seqDB search
MLSLAQLESWFFIAPALLLAVLSGYLAERVGIINIAINGGMVFGGLFMALLSYGFTNNLN
QSAPSWSLFITIPLSVLFSSVIGCLFALAAVKLRADHVIVGTGINLLASGITLFISQNAA
SLFSDTTLRVRYLFPIQTTVSIEAIGVFVFSLLLIGFVWYLMSFTKTGLRYRAVGENPNV
IDTQGISVYKYQWIGAICSMMVAGLSGSLFVLSVSNFPFNSGDVNGLGFIAIAIMIISMW
RIIPSIFIGLIFAYAYVFTNSQIGSNSNSYLLRTIPFIISLLVMLLFGFLNVAPKNIGKH
FDKGLR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtttagcacaattagaaagttggttttttatcgctccagcactgcttttagca
gtattgagtggttatctcgctgaacgcgttgggatcattaatattgctattaatggtgga
atggtgtttggtgggttatttatggcactcttatcgtatggatttacaaataacttaaat
caatccgctccctcctgatcactatttatcaccattcccttatcagttttatttagtagt
gttataggttgtttatttgcactagcagcagttaagttaagagcagatcatgttattgtg
ggaactgggattaacttgttggctagcggaattaccctttttattagtcagaatgctgct
agtttgttttccgatactaccttaagagtaaggtacttatttcccatccaaactactgtt
agtatagaagcaattggtgtgtttgtttttagtttacttctgattgggtttgtatggtac
ttgatgagttttactaaaactgggttgagataccgtgcggtaggtgagaatcctaatgta
attgatacccaagggattagtgtttacaaataccaatggataggcgcaatttgttcaatg
atggtagctggattgagtggtagtttgtttgttttaagtgtttctaactttccctttaac
agcggagatgtaaatggcttgggttttattgctattgccattatgattatctcaatgtga
agaattatccctagcatctttattgggttaatctttgcatatgcctatgtttttaccaat
agtcaaataggatctaatagtaattcctacttgttaagaacgatccctttcatcatctca
ttactagtaatgttgttatttggttttcttaatgttgccccaaaaaatataggtaaacat
tttgacaagggtttaagataa

DBGET integrated database retrieval system