KEGG   Mycoplasma genitalium G37: MG_124Help
Entry
MG_124            CDS       T00002                                 

Gene name
trx
Definition
(GenBank) thioredoxin
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
152768..153076
Genome map
AA seq 102 aa AA seqDB search
MVTEIRSLKQLEEIFSAKKNVIVDFWAAWCGPCKLTSPEFQKAADEFSDAQFVKVNVDDH
TDIAAAYNITSLPTIVVFENGVEKKRAIGFMPKTKIIDLFNN
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagaaattagaagtcttaaacaacttgaagagatcttttcagctaagaaaaat
gttattgttgacttttgagcagcatgatgtggtccttgtaaactaaccagccctgagttt
caaaaagcagcagatgaatttagtgatgctcagtttgttaaggttaatgttgatgatcat
actgatatagcagcagcttataacattacctctttaccaactattgttgtttttgaaaac
ggggttgaaaaaaagagagccattggctttatgccaaaaaccaaaattattgatcttttc
aataactaa

DBGET integrated database retrieval system