KEGG   Mycoplasma genitalium G37: MG_128Help
Entry
MG_128            CDS       T00002                                 

Definition
(GenBank) inorganic polyphosphate/ATP-NAD kinase, probable
  KO
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
mge  Mycoplasma genitalium G37
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MG_128
Enzymes [BR:mge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     MG_128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
155444..156223
Genome map
AA seq 259 aa AA seqDB search
MKYKIFASTTPQTEPVLNKLRAVLKTWQAVENGYEYVFVLGGDGFFVSTLANYNCDSCKV
VGINTGHIGFYTSFNGDDLDENFISKLTSFEFKKINLLEVKTKNHSFLVLNELAVYTNTA
YPINIFIDDNHWESYRGSGLLIGPRTGSTALAKSAKGAVIFPNVDVVQIIELNPLLHPNQ
ITIQSPIILPMQTKVEFRIKKAFKAEQFPNFYADGIKLDLKNEDTSISFQLVLSRSMFHA
SLKTKDFIDKLKSTFIKQS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaatttttgcttccacaacgccccaaactgaacctgttctcaataagtta
agagcagttttaaaaacttggcaagcggttgagaatggttatgaatatgtgtttgtttta
ggtggggatggtttttttgtttccacacttgctaactataactgtgatagttgtaaggta
gttggtatcaatactggccacattggtttttacacttcttttaatggagatgatcttgat
gaaaatttcatttcaaaactaactagctttgagtttaaaaagattaatttactggaagtg
aaaactaaaaaccacagtttcttagttttaaatgaacttgcagtttacaccaacactgca
tatccaattaacatctttattgatgataaccactgggaatcataccgcggttcagggttg
ctaattggcccaagaacaggttcaactgccctagcaaaatctgctaagggagcggttatc
tttccaaatgttgatgttgttcaaattattgaactaaaccccttattacatcccaaccaa
atcacaattcaatctccgattattctgccaatgcaaaccaaggttgaatttaggatcaaa
aaagcttttaaagcagagcaatttcccaatttttatgcagatggaatcaagcttgattta
aaaaatgaagataccagtattagctttcagttggttttatcaagatcaatgtttcacgct
tctttaaaaactaaggattttattgataaactaaaatcaacttttattaagcaaagctaa

DBGET integrated database retrieval system