KEGG   Mycoplasma genitalium G37: MG_133Help
Entry
MG_133            CDS       T00002                                 

Definition
(GenBank) membrane protein, putative
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(158984..159778)
Genome map
AA seq 264 aa AA seqDB search
MLKKSIGIFYRCFYLNNKCDYYLIFLAPFSLFTQIFMVITALISVANSGQMSLIWFTNFD
TFTYQSNSLAIFLVWYYFLNHKSRWFENSSLVLSVTGYLVFTVIFFNFYALSRFTGIVNI
EPDVQGWFSTITTQLPYSFNGSFINDWNAFSELLLHVIHPLFYFIYVGLLFKTYKFIKPP
RNLQSFLLKAGIYPSIYAFYLQTIPFLNVWDNGENSYSVYGFFTQTKYNSYVWIWSIPIF
ASMFLILWMLFVINNHYYGKKHHK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaaaaaatcaattggaattttttaccgttgcttttatcttaacaataaatgcgat
tattatttaatttttctagcacctttttcactattcacccaaatctttatggtgattact
gcactgattagtgttgctaacagtggtcaaatgagcctgatttggtttactaattttgat
acttttacttaccaaagtaatagccttgcaatctttttagtatgatactactttcttaac
cataaaagcagatgatttgaaaacagttcactggttttaagtgttacaggttatctagtt
tttacagttattttctttaacttttatgctttatcacgcttcacaggtattgttaatata
gaacctgatgtacagggttggttttcaactataacaacgcaattaccatatagttttaat
ggttcttttattaatgactggaatgctttttcagagctattactccatgttatccatccg
ttgttttactttatttatgttggattactttttaaaacttataaatttatcaaaccgcca
aggaatttgcaatcctttcttttaaaagcaggcatttatcccagtatctatgctttttat
ctccaaactattccatttttaaatgtttgggataatggtgaaaactcctattcagtgtat
ggattttttacgcaaactaaatataacagttatgtttggatttgatcaatccctattttt
gcatcaatgtttttaatcttatgaatgctttttgttataaataaccattactatggaaaa
aaacaccacaagtag

DBGET integrated database retrieval system