KEGG   Mycoplasma genitalium G37: MG_138Help
Entry
MG_138            CDS       T00002                                 

Gene name
lepA
Definition
(GenBank) GTP-binding protein LepA
  KO
K03596  
GTP-binding protein LepA
Organism
mge  Mycoplasma genitalium G37
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
163591..165387
Genome map
AA seq 598 aa AA seqDB search
MEQKNIRNFSIIAHIDHGKSTLSDRLLEHSLGFEKRLLQAQMLDTMEIERERGITIKLNA
VELKINVDNNNYLFHLIDTPGHVDFTYEVSRSLAACEGVLLLVDATQGIQAQTISNAYLA
LENNLEIIPVINKIDMDNADIETTKDSLHNLLGVEKNSICLVSAKANLGIDQLIQTIIAK
IPPPKGEINRPLKALLFDSYYDPYKGVVCFIRVFDGCLKVNDKVRFIKSNSVYQIVELGV
KTPFFEKRDQLQAGDVGWFSAGIKKLRDVGVGDTIVSFDDQFTKPLAGYKKILPMIYCGL
YPVDNSDYQNLKLAMEKIIISDAALEYEYETSQALGFGVRCGFLGLLHMDVIKERLEREY
NLKLISAPPSVVYKVLLTNGKEISIDNPSLLPERSKIKAISEPFVKVFIDLPDQYLGSVI
DLCQNFRGQYESLNEIDINRKRICYLMPLGEIIYSFFDKLKSISKGYASLNYEFYNYQHS
QLEKVEIMLNKQKIDALSFISHKDFAFKRAKKFCTKLKELIPKHLFEIPIQATIGSKVIA
RETIKAVRKDVIAKLYGGDVSRKKKLLEKQKEGKKRLKAVGSVQLPQELFSHLLKDED
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaaaaacattagaaatttttctattattgcccatattgatcatggtaaatct
accttatcagaccgcttgttagaacatagtttaggctttgaaaaaagactattacaagcg
caaatgcttgatactatggagattgaaagagaaaggggtattaccattaaattaaatgct
gttgaattgaaaattaatgttgataacaacaactatctttttcatttaattgacacccct
gggcatgttgattttacttatgaagtgtctcgttctttagcagcttgtgagggagtttta
ttgttagtagatgcaacccaaggaattcaagcacaaacgatttccaatgcttatcttgcg
ttggaaaataacctggaaattatcccagttattaacaagatagatatggataatgctgat
attgaaacaacaaaagattcactccataacttattaggagttgaaaagaacagtatctgt
ttagtatctgcaaaagctaacttagggattgatcagttaattcaaacaattatagctaag
atccccccaccaaaaggagaaattaatagacctttaaaagcattactctttgatagttac
tatgatccttacaagggggttgtttgttttattagggtatttgatggttgtttaaaggtt
aatgataaggttcgttttattaaaagtaattctgtttaccaaattgtggaactaggggtt
aaaaccccattttttgaaaaaagagatcaattgcaagcaggagatgttggttggttttca
gcagggataaaaaaacttcgtgatgttggggttggtgatactattgttagttttgatgat
caatttacaaaacccctagcaggttataaaaagatcttacccatgatctattgtggttta
tatccagttgataacagtgattatcaaaacctcaagttagcgatggaaaagatcataatc
agtgatgcagcattggaatatgaatatgaaacatcccaagcgttaggttttggggttagg
tgtggttttctaggtcttttacatatggatgttattaaagaaagattggaaagagaatac
aacctaaaactcatctcagctcccccttcagttgtatataaggtgttgttaacaaatggt
aaagagattagtattgacaatccctctttgttaccagaacgctccaagattaaagcaatc
agtgaaccatttgtaaaagtctttattgatttacctgatcaatatttgggcagtgttatt
gatttatgccaaaacttcaggggtcaatatgaaagtttaaatgagattgatatcaacaga
aaaagaatctgttatctgatgcctttaggggaaattatctacagtttttttgataagtta
aagtcgattagtaagggttatgcatcgttaaactatgagttttataactaccaacatagt
caactggaaaaagttgagatcatgttaaacaaacaaaagattgatgcattatcttttatc
agtcataaagactttgcttttaagcgggcaaaaaagttttgcactaagctcaaagaattg
attcccaagcatctgtttgagatccctatccaagcaacaatagggagtaaagtaatagca
agagagacaatcaaagcagttagaaaggatgtaatagctaaactttatggaggggatgtt
agtagaaaaaagaagttattagagaagcaaaaagagggtaaaaaacgcttgaaagcagtt
gggagtgttcaattaccccaagagctatttagtcatttgctgaaagatgaagattaa

DBGET integrated database retrieval system