KEGG   Mycoplasma genitalium G37: MG_273Help
Entry
MG_273            CDS       T00002                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase component E1, beta subunit
  KO
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
mge  Mycoplasma genitalium G37
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MG_273 (pdhB)
   00020 Citrate cycle (TCA cycle)
    MG_273 (pdhB)
   00620 Pyruvate metabolism
    MG_273 (pdhB)
Enzymes [BR:mge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MG_273 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(331235..332215)
Genome map
AA seq 326 aa AA seqDB search
MSKIQVNNIEALNNAMDLALERDQNVVLYGQDAGFEGGVFRATKGLQQKYGSERVWDCPI
AENSMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFVHAARIRNRSRGVYTAPLVVRMP
MGGGIKALEHHSETLEAIYAQIAGLKTVMPSNPYDTKGLFLAAIESPDPVIFFEPKKLYR
AFRQEIPSDYYTVPIGEANLISEGSELTIVSYGPTMFDLINLVYSGELKDKGIELIDLRT
ISPWDKQTVFNSVKKTGRLLVVTEAVKSFTTSAEIITSVTEELFTYLKKAPQRVTGFDIV
VPLARGEKYQFEINARVIDAVNQLLK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatccaagtaaataacattgaagcgttaaacaacgcaatggatcttgcactg
gaaagagatcaaaacgttgtactctatggccaggacgctggttttgaagggggtgtgttc
cgtgcaactaaaggcttacaacaaaagtatgggagtgaaagggtatgggattgtcctata
gcagaaaactctatggctggtattggggttggggctgctataggtggtcttaaacctatt
gtagagatccagttttcaggcttttcattcccagctatgtttcaaatctttgtccatgct
gctaggattagaaaccgttctcgtggtgtatataccgctccactagtagtgaggatgcca
atgggtggggggattaaagcattggaacaccacagtgaaacattggaagcaatttatgca
cagattgctgggcttaaaacagtgatgccatcaaatccttatgataccaaaggacttttt
ctagctgctattgaatcacctgatcctgttatcttttttgaaccaaagaagctttatcgt
gcttttcgtcaggagattcctagtgattattacactgtccctattggtgaagccaacttg
attagtgaaggtagtgaacttacaatagttagctatggtcctacaatgtttgatttaatt
aacttagtttacagcggggaattgaaagataagggaattgagttaattgacttgcgtact
atctccccttgagataaacaaacagtatttaactcagtgaagaaaacaggaagactactt
gtagtgactgaagcggtgaaaagtttcactacaagtgcagagattatcacttcagtaact
gaagaactattcacttatctcaaaaaagccccacaacgggtaactgggtttgatattgtt
gtgcctttagctagaggtgaaaaataccagtttgaaattaatgcacgggttattgatgca
gttaatcaacttttaaaataa

DBGET integrated database retrieval system