KEGG   Mycoplasma genitalium G37: MG_358Help
Entry
MG_358            CDS       T00002                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mge  Mycoplasma genitalium G37
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mge03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
456755..457372
Genome map
AA seq 205 aa AA seqDB search
MITSIFGKVTFVGKRKIIVEHNWISYWFNTKENHKFEKNLEKNKQIFCHIIKKIVANQII
EEAFAFNTLEEKEWFCRLIELNGIGSKTALNLLNNDLEEIKQYILENNYSALCGINGVNN
KIARALLSLEIFEKSENNKNIKGVQVADGYDELFETLKSLGYKQQEIQDALKMIEVKPDF
DISQLVAEVIKLMSFKNNEITNKTA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattacatctatctttggaaaagttacttttgtaggcaaaagaaaaataattgttgag
cacaactggatttcatattgatttaatacaaaagaaaaccataaatttgaaaaaaatttg
gaaaaaaataagcaaattttttgtcatattattaaaaaaattgtcgctaaccaaattata
gaagaggcttttgcctttaatactctagaagaaaaagagtggttctgtagattaatagaa
ctcaatggtattggtagtaaaactgcacttaatttgctcaataatgaccttgaggaaatt
aaacaatacattctggaaaataactacagtgcattatgtggtattaacggtgtaaataac
aaaatagctcgtgcacttttatcacttgaaatatttgaaaaatctgaaaataataaaaat
attaaaggagttcaagttgctgatggttatgatgaattgtttgaaacactaaagtcactt
ggttacaaacaacaagaaattcaggatgcactaaaaatgatagaagtaaaacctgatttt
gatataagtcagttagttgcagaagtaattaaattaatgtcttttaagaataatgaaatt
acaaataaaaccgcctaa

DBGET integrated database retrieval system