KEGG   Mycoplasma genitalium G37: MG_396Help
Entry
MG_396            CDS       T00002                                 

Gene name
rpiB
Definition
(GenBank) ribose 5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mge  Mycoplasma genitalium G37
Pathway
mge00030  Pentose phosphate pathway
mge00051  Fructose and mannose metabolism
mge01100  Metabolic pathways
mge01110  Biosynthesis of secondary metabolites
mge01120  Microbial metabolism in diverse environments
mge01130  Biosynthesis of antibiotics
mge01200  Carbon metabolism
mge01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MG_396 (rpiB)
   00051 Fructose and mannose metabolism
    MG_396 (rpiB)
Enzymes [BR:mge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MG_396 (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: AAC71624
UniProt: P47636
Position
complement(500261..500719)
Genome map
AA seq 152 aa AA seqDB search
MSFNIFIASDHTGLTLKKIISEHLKTKQFNVVDLGPNYFDANDDYPDFAFLVADKVKKNS
DKDLGILICGTGVGVCMAANKVKGVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSEN
IKIVDDFLKANFEGGRHQRRIDKIIRYEKETE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatatctttattgcttctgatcataccggtttaactcttaaaaaaattatt
agtgaacacctaaagactaagcagtttaatgtagttgatcttggccctaattattttgat
gctaatgatgattatcctgactttgcttttttggtagctgataaggtcaagaaaaattct
gataaagatcttgggatactaatttgcggtactggtgttggggtttgtatggcagcaaat
aaagtaaaaggagtattagcggctttggttgttagtgagaaaacagcagctttagctaga
caacatgataatgccaatgttttatgtctttccagtcgttttgtaactgacagtgaaaac
attaaaatagtggatgattttctcaaagctaattttgaaggtggtagacaccaaagacgg
atagataagattattcgatatgaaaaagaaactgaatag

DBGET integrated database retrieval system