KEGG   Mycoplasma genitalium G37: MG_396Help
Entry
MG_396            CDS       T00002                                 

Definition
ribose-5-phosphate isomerase B (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mge  Mycoplasma genitalium G37
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mge01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mge01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mge00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mge00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(500261..500719)
Genome map
AA seq 152 aa AA seqDB search
MSFNIFIASDHTGLTLKKIISEHLKTKQFNVVDLGPNYFDANDDYPDFAFLVADKVKKNS
DKDLGILICGTGVGVCMAANKVKGVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSEN
IKIVDDFLKANFEGGRHQRRIDKIIRYEKETE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatatctttattgcttctgatcataccggtttaactcttaaaaaaattatt
agtgaacacctaaagactaagcagtttaatgtagttgatcttggccctaattattttgat
gctaatgatgattatcctgactttgcttttttggtagctgataaggtcaagaaaaattct
gataaagatcttgggatactaatttgcggtactggtgttggggtttgtatggcagcaaat
aaagtaaaaggagtattagcggctttggttgttagtgagaaaacagcagctttagctaga
caacatgataatgccaatgttttatgtctttccagtcgttttgtaactgacagtgaaaac
attaaaatagtggatgattttctcaaagctaattttgaaggtggtagacaccaaagacgg
atagataagattattcgatatgaaaaagaaactgaatag

DBGET integrated database retrieval system