KEGG   Mycoplasma genitalium G37: MG_396Help
Entry
MG_396            CDS       T00002                                 

Definition
ribose-5-phosphate isomerase B (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mge  Mycoplasma genitalium G37
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MG_396
   01230 Biosynthesis of amino acids
    MG_396
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MG_396
   00051 Fructose and mannose metabolism
    MG_396
Enzymes [BR:mge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MG_396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(500261..500719)
Genome map
AA seq 152 aa AA seqDB search
MSFNIFIASDHTGLTLKKIISEHLKTKQFNVVDLGPNYFDANDDYPDFAFLVADKVKKNS
DKDLGILICGTGVGVCMAANKVKGVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSEN
IKIVDDFLKANFEGGRHQRRIDKIIRYEKETE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatatctttattgcttctgatcataccggtttaactcttaaaaaaattatt
agtgaacacctaaagactaagcagtttaatgtagttgatcttggccctaattattttgat
gctaatgatgattatcctgactttgcttttttggtagctgataaggtcaagaaaaattct
gataaagatcttgggatactaatttgcggtactggtgttggggtttgtatggcagcaaat
aaagtaaaaggagtattagcggctttggttgttagtgagaaaacagcagctttagctaga
caacatgataatgccaatgttttatgtctttccagtcgttttgtaactgacagtgaaaac
attaaaatagtggatgattttctcaaagctaattttgaaggtggtagacaccaaagacgg
atagataagattattcgatatgaaaaagaaactgaatag

DBGET integrated database retrieval system