KEGG   Mycoplasma genitalium G37: MG_431Help
Entry
MG_431            CDS       T00002                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mge  Mycoplasma genitalium G37
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mge00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MG_431 (tpiA)
   01230 Biosynthesis of amino acids
    MG_431 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MG_431 (tpiA)
   00051 Fructose and mannose metabolism
    MG_431 (tpiA)
   00562 Inositol phosphate metabolism
    MG_431 (tpiA)
Enzymes [BR:mge01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MG_431 (tpiA)
Exosome [BR:mge04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MG_431 (tpiA)
  Exosomal proteins of bladder cancer cells
   MG_431 (tpiA)
  Exosomal proteins of melanoma cells
   MG_431 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537557..538291)
Genome map
AA seq 244 aa AA seqDB search
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIKKIISDSLLLF
AQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQ
VVLCIGEALGQEISFLKTDLTNCLDTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTI
KTIREYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMA
RVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaggtatttaattggcaattggaaaacaaataaaaatttaaaagacgcagtt
agttttgttgaacaatttcaacaaaataaacttaattacaatgccaaaattgggatagca
cctgtttatgttcatctcactgaaataaaaaaaataattagtgatagtctccttttattt
gcccaagacgctaactttattgaaagtggttcatatactggaactgtaagctttactcaa
cttcaagacattggtgttaacaacagtattattggtcattctgaaagaagaaaatactat
aacgaaaccagtgcagttattaatcaaaagctctttgcttgtctaaaagcatccatgcaa
gtagttttatgtattggtgaggctttaggacaagagattagctttcttaaaactgatctt
actaattgcttagatacgattgacaaaagcttaattaaaaatttagttattgcttatgaa
cctttgtgagcaattgggacaggtaaaacagcaactcctgaagttgcaaatcaaaccatt
aaaaccattagggaatatattaatgacttatatgatgaaaatgttgctaacaatatctca
attctatatggcggatcagttgatcataataatatccaaaaactagcaataatggaacaa
attgatggatttttagttggtaaagcatctttagaaattaaaaactttttagaaatggct
agggtatatgcataa

DBGET integrated database retrieval system